BioLiP

>protein
MAHHHHHHNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENF
KLTMVKRNNQTIFEQTINDLTF

The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ghf:A	102	102	1.0000	1.0000	1.0000	5.46e-74
2	2yt9:A	95	61	0.1569	0.1684	0.2623	0.63
3	1klr:A	30	26	0.0784	0.2667	0.3077	0.64	1kls:A, 1xrz:A, 5znf:A, 7znf:A
4	3lvt:A	833	34	0.1275	0.0156	0.3824	0.94
5	7xt2:B	388	29	0.1275	0.0335	0.4483	1.0	7xt2:A
6	7xyz:B	456	29	0.1275	0.0285	0.4483	1.0	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
7	7sjr:A	911	25	0.0980	0.0110	0.4000	1.8	6ppj:A
8	7ysf:A	113	46	0.1275	0.1150	0.2826	3.4
9	8fjl:D	1138	25	0.1275	0.0114	0.5200	4.3	8fjk:E, 8fjk:G, 8fjk:I, 8fjk:K, 8fjl:E, 8fjl:G, 8fjl:I, 8fjl:K, 6m99:C
10	7lw7:A	277	26	0.0882	0.0325	0.3462	4.5	7lw8:A, 7lw9:A, 7lwa:A
11	7b9v:N	264	50	0.1275	0.0492	0.2600	4.6
12	7dco:Q	292	50	0.1275	0.0445	0.2600	4.7	6j6g:Q, 6j6h:Q, 6j6n:Q, 6j6q:Q
13	2i13:B	144	32	0.1275	0.0903	0.4062	4.7
14	5mps:N	227	50	0.1275	0.0573	0.2600	4.9	5lj3:N, 5lj5:N, 5mq0:N
15	6exn:N	242	50	0.1275	0.0537	0.2600	5.2	6bk8:F
16	7ajt:JA	812	46	0.1373	0.0172	0.3043	6.2	7d63:RL, 6ke6:RL, 6lqp:RL, 6lqq:RL, 6lqr:RL, 6lqu:RL, 6lqv:RL, 7suk:LX, 6zqb:JA, 6zqc:JA
17	5y88:M	182	48	0.1275	0.0714	0.2708	6.2
18	5gm6:Q	185	48	0.1275	0.0703	0.2708	7.7	5gmk:Q, 5wsg:Q, 5ylz:M
19	8f2m:D	434	39	0.1275	0.0300	0.3333	7.9
20	6m5u:A	585	45	0.1471	0.0256	0.3333	8.0	4iox:C, 6m5v:A
21	2y6o:A	263	34	0.1078	0.0418	0.3235	9.7	2xyu:A

[Back]