MAEIYLAGGCFWGLEEYFSRISGVLETSVGYANGQVETTNYQLLKETDHAETVQVIYDEKEVSLREILLYYFRVIDPLSI
NQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSGYCHIDVTDADKP
LIDAANYEKPSQEVLKASLSEESYRVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFFAKDKFASGCGWPSFSRPLSK
ELIHYYKDLSHGMERIEVRSRSGSAHLGHVFTDGPRELGGLRYCINSASLRFVAKDEMEKAGYGYLLPYLNK
The query sequence (length=312) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3e0m:C | 313 | 312 | 1.0000 | 0.9968 | 1.0000 | 0.0 | 3e0m:A, 3e0m:B |
2 | 7e43:B | 324 | 309 | 0.5865 | 0.5648 | 0.5922 | 6.61e-135 | 7e43:A |
3 | 3bqf:A | 167 | 160 | 0.2660 | 0.4970 | 0.5188 | 1.50e-55 | |
4 | 3hch:A | 145 | 140 | 0.2436 | 0.5241 | 0.5429 | 2.38e-52 | 3hch:B |
5 | 6sym:A | 135 | 132 | 0.2212 | 0.5111 | 0.5227 | 7.97e-41 | 6sym:B |
6 | 3cxk:A | 131 | 121 | 0.2051 | 0.4885 | 0.5289 | 1.48e-38 | 3cez:A, 3cez:B, 3cxk:B |
7 | 6q9v:B | 145 | 123 | 0.1827 | 0.3931 | 0.4634 | 8.00e-31 | 6q9v:A, 6qa0:A, 6qa0:B |
8 | 2k8d:A | 151 | 128 | 0.1859 | 0.3841 | 0.4531 | 1.48e-30 | |
9 | 6tr8:A | 136 | 137 | 0.1891 | 0.4338 | 0.4307 | 4.85e-28 | |
10 | 4d7l:A | 213 | 161 | 0.1859 | 0.2723 | 0.3602 | 1.61e-23 | 4d7l:B, 4d7l:C |
11 | 3hci:A | 153 | 140 | 0.1731 | 0.3529 | 0.3857 | 2.42e-22 | 3hci:B, 3hcj:A, 3hcj:B |
12 | 4lwm:A | 205 | 142 | 0.1442 | 0.2195 | 0.3169 | 6.39e-17 | |
13 | 3mao:A | 105 | 104 | 0.1090 | 0.3238 | 0.3269 | 5.45e-07 | |
14 | 6z1p:BL | 181 | 134 | 0.1122 | 0.1934 | 0.2612 | 0.022 | |
15 | 7x8k:B | 367 | 114 | 0.1122 | 0.0954 | 0.3070 | 1.2 | 7x8k:A, 7x8k:D |
16 | 5iji:A | 227 | 78 | 0.0577 | 0.0793 | 0.2308 | 1.4 | 5jef:A, 5jef:B, 5jgp:A |
17 | 4url:A | 364 | 69 | 0.0673 | 0.0577 | 0.3043 | 4.3 | 4url:B, 4urn:A, 4urn:B, 4urn:C |
18 | 5t9g:C | 811 | 51 | 0.0545 | 0.0210 | 0.3333 | 4.4 | 5t9g:A, 5t9g:B, 5t9g:D |
19 | 6se3:D | 528 | 27 | 0.0385 | 0.0227 | 0.4444 | 4.5 | 6se3:A, 6se3:B, 6se3:C, 6se3:E, 6se3:F |
20 | 3eo8:A | 219 | 35 | 0.0417 | 0.0594 | 0.3714 | 4.6 | 3eo8:B, 3eo8:C, 3eo8:D, 3eo8:E, 3eo8:F |
21 | 1e3d:B | 537 | 138 | 0.1026 | 0.0596 | 0.2319 | 6.4 | 1e3d:D |