BioLiP

>protein
MAAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFI
IGELHPDDRSKLSKPMETLITTVD

The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2i96:A	108	104	0.9135	0.8796	0.9135	4.61e-68	4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A
2	1hko:A	104	103	0.8654	0.8654	0.8738	9.64e-65	1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A
3	1aw3:A	94	94	0.8269	0.9149	0.9149	1.22e-60	1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A
4	3ozz:B	82	81	0.6346	0.8049	0.8148	2.67e-47
5	2i89:A	90	84	0.5769	0.6667	0.7143	1.10e-42	2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B
6	1awp:A	86	83	0.4808	0.5814	0.6024	8.55e-36	1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A
7	3ner:B	91	80	0.4904	0.5604	0.6375	4.44e-35	3ner:A
8	2ibj:A	86	84	0.4904	0.5930	0.6071	6.41e-34
9	4b8n:B	90	74	0.2981	0.3444	0.4189	4.51e-13	4b8n:A, 4b8n:C, 4b8n:D
10	3lf5:A	87	72	0.2500	0.2989	0.3611	1.20e-12	3lf5:B
11	1kbi:A	504	49	0.2212	0.0456	0.4694	1.41e-11	1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B
12	1cxy:A	81	77	0.2500	0.3210	0.3377	1.86e-11
13	8tgb:A	108	76	0.2308	0.2222	0.3158	1.52e-10	8tgb:B
14	1x3x:A	82	51	0.2404	0.3049	0.4902	3.97e-10	1x3x:B
15	7bwh:A	88	84	0.2596	0.3068	0.3214	5.25e-10
16	1sox:A	463	81	0.2788	0.0626	0.3580	1.40e-06	2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B
17	1mj4:A	79	73	0.2308	0.3038	0.3288	1.69e-05
18	3e23:A	198	65	0.2019	0.1061	0.3231	0.14
19	1u8x:X	436	98	0.2500	0.0596	0.2653	1.6
20	4rdr:A	706	52	0.1635	0.0241	0.3269	4.8
21	3ats:A	352	27	0.1058	0.0312	0.4074	5.1	3att:A
22	8wg1:D	685	50	0.1250	0.0190	0.2600	7.5	8wg0:A, 8wg0:B, 8wg0:C, 8wg0:D, 8wg1:A, 8wg1:B, 8wg1:C, 8wg2:A, 8wg2:B, 8wg2:C, 8wg2:D
23	2d2c:D	168	24	0.1058	0.0655	0.4583	7.8	2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q
24	4cc5:A	308	73	0.2019	0.0682	0.2877	8.5	4cc6:A, 5fpo:A, 5fpr:A

[Back]