Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MAAGVGIFIGYIAVFTGVTLGLLYGLRFVKLI

The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7r0w:M 32 32 1.0000 1.0000 1.0000 7.73e-15 7r0w:E, 7zxy:E, 7zxy:M
2 4h44:E 31 25 0.4062 0.4194 0.5200 0.001 4ogq:E, 2zt9:E
3 2e74:E 32 32 0.3438 0.3438 0.3438 1.1 2e75:E, 4h0l:E, 4h13:E
4 5xy3:H 192 30 0.3750 0.0625 0.4000 2.1
5 8bx1:A 127 22 0.3125 0.0787 0.4545 3.2
6 8g8e:X 140 22 0.3125 0.0714 0.4545 3.2 8g87:X, 8g88:X, 8g8b:X, 8g8g:X, 8sps:M, 7u0g:K
7 3l1p:A 147 22 0.3125 0.0680 0.4545 3.2 8bx2:A, 6ht5:E, 3l1p:B, 8sps:L, 8spu:L, 6t90:K, 7u0g:M, 7u0g:L, 7u0i:L, 7u0i:M
8 8jiv:CH 186 16 0.2812 0.0484 0.5625 8.9 8ip8:FA, 8ipa:FA, 8ipb:FA
9 5mgy:H 316 24 0.2500 0.0253 0.3333 9.9 5mgy:B, 5mgy:G, 5mgy:A, 5mgy:C, 5mgy:D, 5mgy:F

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218