BioLiP

>protein
MAAAAVSSAKRSLRGELKQRLMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPR
YRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQ
HQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYED

The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3hy6:A	198	198	0.9949	0.9798	0.9798	1.31e-141	3hxt:A, 3hy3:A, 3hy4:A
2	2jcb:A	194	154	0.2308	0.2320	0.2922	1.16e-08	2jcb:B
3	1u3f:A	164	157	0.1949	0.2317	0.2420	3.04e-05	1u3f:B, 1u3g:A
4	4r7p:A	485	94	0.1077	0.0433	0.2234	3.1	4r7p:B, 4r7p:C
5	8v83:m	211	37	0.0667	0.0616	0.3514	3.9	8v84:m
6	1pz1:A	333	36	0.0667	0.0390	0.3611	4.9	1pz1:B
7	2dfj:A	267	48	0.0821	0.0599	0.3333	5.2	2dfj:B
8	1iom:A	374	51	0.0872	0.0455	0.3333	6.5	1ixe:A, 1ixe:B, 1ixe:C, 1ixe:D
9	3fe2:A	234	96	0.1231	0.1026	0.2500	6.5	3fe2:B
10	3vsz:C	482	53	0.0667	0.0270	0.2453	6.6	3vsz:A, 3vsz:B, 3vsz:E, 3vsz:F, 3vt0:A, 3vt0:B, 3vt0:C, 3vt0:E, 3vt0:F, 3vt1:B, 3vt1:C, 3vt1:E, 3vt1:F, 3vt1:A, 3vt2:A, 3vt2:B, 3vt2:C, 3vt2:D, 3vt2:E, 3vt2:F
11	6r1n:A	420	178	0.1795	0.0833	0.1966	8.6
12	4ilk:A	337	33	0.0615	0.0356	0.3636	9.1	4ilk:B
13	7sgl:D	406	28	0.0564	0.0271	0.3929	9.9	7abs:A, 7af1:A, 7afs:A, 7afu:A, 7agi:A, 7apv:A, 6tt5:AAA, 6wnl:A, 6wnl:B, 6wo0:A

[Back]