LYGRYNCKCCWFADTNLITCNDHYLCLRCHQTMLRNSELCHICWKPLPT
The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ckm:B | 49 | 49 | 1.0000 | 1.0000 | 1.0000 | 6.31e-32 | 7el9:B, 7el9:E, 7elb:B, 7elb:D, 7elc:B, 7vgq:B, 7vh1:B |
2 | 7x6v:B | 48 | 47 | 0.4286 | 0.4375 | 0.4468 | 6.40e-08 | |
3 | 2m1s:A | 99 | 47 | 0.4898 | 0.2424 | 0.5106 | 3.49e-06 | 7ckl:B, 7ela:B, 5i72:A, 5i72:B |
4 | 7oik:A | 4426 | 53 | 0.3469 | 0.0038 | 0.3208 | 0.29 | 7oim:A, 6tax:A, 6tay:A |
5 | 1fgx:B | 273 | 25 | 0.2245 | 0.0403 | 0.4400 | 2.3 | 1fr8:A, 1fr8:B, 2fyd:B, 2fyd:D, 1nf5:B, 1nf5:D, 1nhe:B, 1nhe:D, 1nkh:B, 1nkh:D, 1nwg:B, 1nwg:D, 1o23:B, 1o23:D, 1oqm:B, 1oqm:D, 1pzy:B, 1pzy:D, 1yro:B, 1yro:D |
6 | 2agd:A | 273 | 25 | 0.2245 | 0.0403 | 0.4400 | 2.4 | 2ae7:A, 2ae7:B, 2ae7:C, 2aec:A, 2aec:B, 2aec:C, 2aes:A, 2aes:B, 2aes:C, 2agd:B, 2agd:C, 2ah9:A, 2ah9:B, 2ah9:C, 3ee5:A, 3ee5:B, 3ee5:C, 4ee3:A, 4ee3:B, 4ee3:C, 4ee4:A, 4ee4:B, 4ee4:C, 4ee5:A, 4ee5:B, 4ee5:C, 4eea:A, 4eea:B, 4eea:C, 4eeg:A, 4eeg:B, 4eeg:C, 4eem:A, 4eem:B, 4eem:C, 4eeo:A, 4eeo:B, 4eeo:C, 2fya:A, 2fyb:A, 2fyc:B, 2fyc:D, 4krv:A, 4krv:B, 1o0r:A, 1o0r:B, 1tvy:A, 1tvy:B, 1tw1:A, 1tw1:B, 1tw5:A, 1tw5:B |
7 | 6yxa:A | 536 | 10 | 0.1224 | 0.0112 | 0.6000 | 3.1 | 8acu:A, 8acu:B |
8 | 6k15:H | 393 | 27 | 0.1633 | 0.0204 | 0.2963 | 5.8 | 6kw4:H, 6kw5:H, 6v8o:I, 6v92:I |
9 | 6tda:L | 596 | 27 | 0.1633 | 0.0134 | 0.2963 | 5.9 | |
10 | 5a22:A | 2002 | 34 | 0.2245 | 0.0055 | 0.3235 | 5.9 | |
11 | 6u1x:A | 2059 | 34 | 0.2245 | 0.0053 | 0.3235 | 5.9 | |
12 | 2csy:A | 81 | 43 | 0.2857 | 0.1728 | 0.3256 | 9.0 | |
13 | 6a6u:A | 432 | 20 | 0.1837 | 0.0208 | 0.4500 | 9.5 | 6a6r:A, 6a6s:A, 6a6t:A, 6a6v:A, 6a6v:H |