BioLiP

>protein
LWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEG
TLILLFGGIPYLWRLSGRPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCI
LLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEG
SKRSSHSNAYFYGFFKNKRIVLFDTLLEQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELF
AAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFS
MWHYSHPPLLERLQALKTM

The query sequence (length=419) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ypt:A	424	419	0.9905	0.9788	0.9905	0.0	2ypt:B, 2ypt:D, 2ypt:E
2	5syt:A	444	445	0.9761	0.9212	0.9191	0.0	4aw6:A, 4aw6:B, 4aw6:D, 4aw6:E, 6bh8:B
3	6bh8:A	371	419	0.8663	0.9784	0.8663	0.0
4	4il3:B	431	421	0.3938	0.3828	0.3919	2.37e-89	4il3:A
5	1l9m:B	681	55	0.0430	0.0264	0.3273	0.31	1l9m:A, 1l9n:A, 1l9n:B, 1nud:A, 1nud:B, 1nuf:A, 1nug:A, 1nug:B, 8oxv:A, 8oxw:A, 8oxx:A
6	6tdw:H	249	57	0.0453	0.0763	0.3333	0.50
7	4j1q:A	417	44	0.0382	0.0384	0.3636	4.8
8	2qo3:B	873	53	0.0358	0.0172	0.2830	4.8	2qo3:A
9	5vpw:B	458	64	0.0406	0.0371	0.2656	5.7	1mio:B, 1mio:D, 5vpw:D, 5vq3:B, 5vq3:D, 4wes:B, 4wes:D, 4wn9:B, 4wn9:D
10	8wrk:A	434	61	0.0477	0.0461	0.3279	8.3	8in7:A, 8ina:A, 8ind:A, 8inj:A, 8ino:A, 8inv:A, 8wrj:A
11	5lhd:C	905	33	0.0310	0.0144	0.3939	9.1	6atk:C, 6atk:A, 6atk:B, 4fyq:A, 4fyr:A, 4fys:A, 4fyt:A, 5lhd:D, 5lhd:A, 5lhd:B, 6u7e:A, 6u7e:B, 6u7f:A, 6u7f:B, 6u7g:A, 6u7g:B, 7vpq:A, 7vpq:C, 7vpq:E
12	4v7e:CG	237	19	0.0286	0.0506	0.6316	9.9	8ip8:AA, 8ipa:AA, 8ipb:AA, 8jiv:CG, 4v3p:LH

[Back]