LVDTTEMYLRTIYELEAEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAE
RLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINE
IFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRI
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1c0w:B | 219 | 214 | 0.9953 | 0.9589 | 0.9813 | 1.81e-148 | 1bi0:A, 1bi3:A, 1bi3:B, 1c0w:A, 1c0w:C, 1ddn:A, 1ddn:B, 1ddn:C, 1ddn:D, 2dtr:A, 1f5t:A, 1f5t:B, 1f5t:C, 1f5t:D, 1fwz:A, 1g3w:A, 1g3y:A |
2 | 1c0w:D | 175 | 210 | 0.8152 | 0.9829 | 0.8190 | 4.88e-114 | |
3 | 1fx7:A | 230 | 224 | 0.6114 | 0.5609 | 0.5759 | 1.18e-77 | 1b1b:A, 1fx7:B, 1fx7:C, 1fx7:D, 2isz:A, 2isz:B, 2isz:C, 2isz:D, 2it0:A, 2it0:B, 2it0:C, 2it0:D, 1u8r:A, 1u8r:B, 1u8r:C, 1u8r:D, 1u8r:G, 1u8r:H, 1u8r:I, 1u8r:J |
4 | 7b20:B | 228 | 223 | 0.5735 | 0.5307 | 0.5426 | 2.43e-75 | 7b1v:A, 7b1v:B, 7b1y:A, 7b1y:B, 7b1y:C, 7b1y:D, 7b1y:dd, 7b1y:aa, 7b20:A, 7b20:C, 7b20:D, 7b20:dd, 7b20:aa, 7b23:A, 7b23:B, 7b23:C, 7b23:D, 7b23:dd, 7b23:aa, 7b24:A, 7b24:B, 7b24:C, 7b24:D, 7b24:dd, 7b24:aa, 7b25:A, 7b25:B, 7b25:C, 7b25:D, 7b25:dd, 7b25:aa |
5 | 8pw0:A | 137 | 133 | 0.2085 | 0.3212 | 0.3308 | 1.06e-16 | |
6 | 5cvi:B | 215 | 127 | 0.2038 | 0.2000 | 0.3386 | 1.58e-15 | 5cvi:A |
7 | 6o5c:A | 215 | 211 | 0.2559 | 0.2512 | 0.2559 | 2.02e-15 | 6o5c:B |
8 | 5zr6:A | 214 | 127 | 0.2038 | 0.2009 | 0.3386 | 5.05e-15 | 5zr6:B |
9 | 3hru:A | 211 | 211 | 0.2512 | 0.2512 | 0.2512 | 3.55e-13 | 3hru:B |
10 | 4o5v:A | 213 | 127 | 0.1943 | 0.1925 | 0.3228 | 5.02e-10 | 4o6j:A |
11 | 2x4h:C | 131 | 123 | 0.1611 | 0.2595 | 0.2764 | 5.27e-06 | 2x4h:A, 2x4h:B, 2x4h:D |
12 | 6ktb:B | 138 | 109 | 0.1469 | 0.2246 | 0.2844 | 1.54e-05 | |
13 | 6mh5:B | 375 | 168 | 0.1896 | 0.1067 | 0.2381 | 1.1 | 6mh5:A |
14 | 5ffz:A | 140 | 70 | 0.1043 | 0.1571 | 0.3143 | 1.7 | 5fb2:A, 4lll:C, 4lll:D, 4lll:A, 4lll:B, 4lll:I, 4lll:J, 4lln:A, 4lln:B, 4lln:C, 4lln:D, 4lln:I, 4lln:J |
15 | 1r0l:B | 379 | 53 | 0.0711 | 0.0396 | 0.2830 | 1.9 | 1r0l:A, 1r0l:C, 1r0l:D |
16 | 5e1z:B | 169 | 45 | 0.0711 | 0.0888 | 0.3333 | 4.0 | 5e1x:A, 5e20:A |
17 | 5lzt:jj | 428 | 34 | 0.0569 | 0.0280 | 0.3529 | 5.8 | 4d61:i, 5hxb:X, 5hxb:A, 7nwh:jj, 6xk9:X, 6xk9:A |
18 | 8br8:LU | 157 | 93 | 0.1090 | 0.1465 | 0.2473 | 6.4 | 8brm:LU, 8bsi:LU, 8bsj:LU, 8btd:LU, 8btr:LU, 8fru:T, 7pwg:T, 7pwo:T2 |
19 | 7z8f:e | 4579 | 110 | 0.1232 | 0.0057 | 0.2364 | 8.3 | 5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A |
20 | 8ptk:f | 4502 | 110 | 0.1232 | 0.0058 | 0.2364 | 8.5 | 8ptk:e |
21 | 2iry:A | 288 | 40 | 0.0758 | 0.0556 | 0.4000 | 8.5 | 2irx:A, 2iry:B, 4mky:B, 4mky:A, 4mky:C, 4mky:D, 3pky:A, 3pky:B, 2r9l:A, 2r9l:B |
22 | 6s8w:C | 470 | 40 | 0.0711 | 0.0319 | 0.3750 | 9.3 |