BioLiP

>protein
LTPAEVLFDLPACDHYAGSEKLMLKSLALQQQLGPVFDITLDCEDGAQVGREAQHAELVASLLGSEHDRFGRVGVRIHDF
DHAHWRDDVRLILRAAKRAPAYITLPKIRHVHDAAEMVAFIEATRRELGIAQPVPVQLLVETHGALTRVFDLAALPGVEA
LSFGLMDFVSAHDGAIPDTAMRSPGQFDHPLVRRAKLEISAACHAYGKVPSHNVSTEVRDMSVVANDAARARNEFGYTRM
WSIHPAQIEAIVAAFAPRDEEITTATEILLAAQSAQWGPTRYHDTLHDRASYRYYWSVLRRAQATGRAVPQDAAPLF

The query sequence (length=317) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3r4i:A	321	320	1.0000	0.9875	0.9906	0.0	3r4i:B, 3r4i:C, 3r4i:D, 3r4i:E, 3r4i:F
2	4l9y:C	316	281	0.2524	0.2532	0.2847	9.73e-17	4l9y:A, 4l9y:B, 4l9y:D, 4l9y:E, 4l9y:F, 4l9z:A, 4l9z:B, 4l9z:C, 4l9z:D, 4l9z:E, 4l9z:F
3	5ugr:A	323	255	0.2177	0.2136	0.2706	3.06e-08
4	4l80:C	347	257	0.1735	0.1585	0.2140	0.002	6kkh:C, 6kkh:F, 6kkh:I, 6kkh:L, 4l80:A, 4l80:B, 4l80:D, 4l80:F, 4l80:E
5	5vxc:A	301	281	0.2019	0.2126	0.2278	0.006	5vxo:A, 5vxo:B, 5vxo:C
6	6aq4:B	268	266	0.2145	0.2537	0.2556	0.008	6aq4:A, 6aq4:C, 6arb:A, 6arb:B, 6arb:C, 6as5:A, 6as5:C, 6as5:B, 6chu:A, 6cj3:A, 6cj4:A, 1u5v:A, 1z6k:A
7	3qup:A	241	90	0.0820	0.1079	0.2889	0.046	4feq:A, 4ff8:A
8	7zrn:A	301	111	0.0978	0.1030	0.2793	4.8	7zrn:B
9	8odp:A	505	75	0.0726	0.0455	0.3067	5.1	8btt:A, 8odo:A, 8odo:C, 8odo:E, 8odo:G, 8odp:C, 8odp:E, 8odp:G, 7p3b:A, 7p3b:B

[Back]