BioLiP

>protein
LTCVTDKSFGGVITEECAAGQKICFKNWKKMGPKLYDVKRGCTATCPKADDNGCVKCCNTDKCNK

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7c28:A	65	65	1.0000	1.0000	1.0000	1.90e-42	7c28:B
2	5mg9:A	65	65	0.5385	0.5385	0.5385	4.97e-20
3	2bhi:A	60	53	0.3385	0.3667	0.4151	1.71e-07	2bhi:B, 1h0j:A, 1h0j:B, 1h0j:C, 1xt3:A
4	1v6p:A	62	65	0.3231	0.3387	0.3231	0.002	1v6p:B
5	8vy8:B	75	51	0.3077	0.2667	0.3922	0.009	1abt:A, 2btx:A, 1bxp:A, 1haa:A, 1haj:A, 5hbv:A, 1hc9:A, 1hc9:B, 1hoy:A, 1idg:A, 1idh:A, 1jbd:A, 1kc4:A, 1kl8:A, 1l4w:A, 1ljz:A, 2qc1:A, 1rgj:A, 6uwz:G, 8vy8:A, 8vy8:E, 8vy8:G
6	7vwa:A	138	35	0.2000	0.0942	0.3714	0.060
7	1lxg:A	71	27	0.2000	0.1831	0.4815	0.22	1lxh:A, 7pc0:K, 6zfm:A, 6zfm:B, 6zfm:D, 6zfm:E
8	9avv:G	62	65	0.3077	0.3226	0.3077	1.4	9avv:F, 9awk:F, 9awk:G
9	5ebx:A	62	63	0.2615	0.2742	0.2698	2.8	6ebx:B
10	3edy:A	544	19	0.1231	0.0147	0.4211	3.2	3ee6:A, 3ee6:B
11	6ncz:C	589	44	0.2154	0.0238	0.3182	4.1	6ncz:A, 6ncz:B, 6ncz:D, 6ncz:E, 6ncz:F
12	1zrt:D	248	35	0.2154	0.0565	0.4000	4.2	6xi0:D, 6xi0:Q, 6xkt:D, 6xkt:Q, 6xku:D, 6xku:Q, 6xkv:D, 6xkv:Q, 6xkw:D, 6xkw:Q, 6xkx:D, 6xkx:Q, 6xkz:D, 6xkz:Q, 1zrt:Q

[Back]