BioLiP

>protein
LTCDQLPKAAINPIQEFIDSNPLEFEYVLTETFECTTRIYVQPARWSTTKAPTALDIKGTQIMAYDFVGGPENSAHLNEC
HTGDKQVWYFQYTNLLTDNGSSYCAYRCNGTEIIEYKCASNNNGTDPLQHQAMEVAKTVPNGDKIHYAKSNCPETHGCFA
FY

The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6kfa:A	162	162	1.0000	1.0000	1.0000	2.53e-123	6kfb:A, 6kfd:A
2	7yax:A	166	162	0.7284	0.7108	0.7284	2.46e-88	7yax:B, 7yax:C, 7yax:D, 7ycb:A, 7ycb:B, 7ycb:C, 7ycb:D, 7ycd:A, 7ycd:B, 7ycd:C, 7ycd:D, 7ycf:A, 7ycf:B, 7ycf:C, 7ycf:D, 7yct:A, 7yct:B, 7yct:C, 7yct:D
3	7bpo:A	165	163	0.5000	0.4909	0.4969	3.94e-52	7bpo:B, 7br1:A, 7br1:B
4	2q46:A	253	49	0.0864	0.0553	0.2857	1.9	2q46:B, 2q4b:A, 2q4b:B, 1xq6:A, 1xq6:B, 1ybm:A, 1ybm:B
5	7aat:A	401	35	0.0802	0.0324	0.3714	2.5	7aat:B, 8aat:A, 8aat:B, 9aat:A, 9aat:B, 1aka:A, 1aka:B, 1akb:A, 1akc:A, 1ama:A, 1ivr:A, 1map:A, 1maq:A, 1oxo:A, 1oxo:B, 1oxp:A, 1tar:A, 1tar:B, 1tas:A, 1tas:B, 1tat:A, 1tat:B
6	7q4i:B	281	30	0.0864	0.0498	0.4667	2.8	7q4i:A
7	8ioo:A	327	27	0.0679	0.0336	0.4074	6.9	8ioo:B, 8ioo:C
8	2chq:A	313	24	0.0617	0.0319	0.4167	8.5	2chg:A, 2chg:B, 2chg:C, 2chg:D, 2chq:B, 2chq:C
9	7su3:A	3802	25	0.0679	0.0029	0.4400	9.4

[Back]