BioLiP

>protein
LTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA

The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1jgn:A	98	79	1.0000	0.8061	1.0000	1.09e-51	7bn3:C, 7bn3:A, 7bn3:B, 1jh4:A, 3ktp:A, 3ktr:A, 3kui:A, 3kuj:A, 3kus:A, 3kus:B, 3kut:A, 3kut:B, 3pkn:A, 3pth:A, 2rqg:B, 2rqh:B, 8smo:A, 8smo:C, 8smo:E, 8smo:G, 8smo:I, 8smo:K, 8smo:M, 8smo:O, 2x04:A, 2x04:B
2	6h7b:A	78	75	0.4177	0.4231	0.4400	5.49e-14	6h7b:C
3	3ntw:A	61	58	0.3924	0.5082	0.5345	9.70e-14	3ntw:C
4	3ppu:A	314	51	0.2025	0.0510	0.3137	0.33
5	7opl:A	1070	36	0.2025	0.0150	0.4444	1.7	6as7:A, 9c8v:C, 8d96:C, 8d9d:C, 5exr:C, 5exr:G, 5iud:A, 5iud:D, 5iud:G, 5iud:J, 7n2m:A, 4q5v:A, 4q5v:E, 4qcl:A, 8qj7:A, 7u5c:C, 8vy3:C, 4y97:B, 4y97:D, 4y97:F, 4y97:H
6	4rtl:A	254	70	0.2658	0.0827	0.3000	2.4	2g1p:A, 2g1p:B, 4gbe:D, 4gbe:E, 4gbe:F, 4gol:D, 4gol:E, 4gol:F, 4gom:D, 4gom:E, 4gom:F, 4gon:D, 4gon:E, 4gon:F, 4goo:D, 4goo:E, 4goo:F, 2ore:D, 2ore:E, 2ore:F, 4rtj:A, 4rtk:A, 4rtm:A, 4rtn:A, 4rto:A, 4rtp:A, 4rtq:A, 4rtr:A, 4rts:A
7	6nlx:C	335	42	0.1772	0.0418	0.3333	3.3	6nlx:B, 6nlx:D, 5ur0:A, 5ur0:B, 5ur0:C, 5ur0:D
8	1tec:E	279	21	0.1266	0.0358	0.4762	4.5	2tec:E, 3tec:E, 1thm:A
9	6l1h:B	305	43	0.1772	0.0459	0.3256	8.3	6l1h:A
10	5ci5:A	393	23	0.1392	0.0280	0.4783	8.5	5ci5:B

[Back]