LSYQSHDCSGACLNPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQ
LAR
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hfp:C | 87 | 85 | 1.0000 | 0.9540 | 0.9765 | 1.44e-56 | 8hfp:D |
2 | 7fhj:B | 107 | 73 | 0.2169 | 0.1682 | 0.2466 | 0.002 | 7mwh:B, 7mwl:B |
3 | 3vxv:A | 65 | 61 | 0.1687 | 0.2154 | 0.2295 | 0.33 | 3vxx:A, 3vyb:A, 3vyq:A, 3vyq:D |
4 | 6v9q:A | 454 | 61 | 0.2169 | 0.0396 | 0.2951 | 3.6 | 6vbw:A |
5 | 6pif:G | 521 | 61 | 0.2169 | 0.0345 | 0.2951 | 3.9 | 6lnb:H, 6lnc:H, 6pig:G, 6pij:G |
6 | 8ouw:6 | 707 | 20 | 0.1084 | 0.0127 | 0.4500 | 4.3 | |
7 | 3nk3:A | 284 | 14 | 0.0964 | 0.0282 | 0.5714 | 5.2 | 3nk3:B, 3nk4:A, 3nk4:B |
8 | 3ihp:B | 681 | 32 | 0.1446 | 0.0176 | 0.3750 | 5.3 | 6dxh:A, 6dxt:A, 6dxt:B, 2g43:A, 2g43:B, 2g45:A, 2g45:D, 3ihp:A, 7ms5:A, 7ms5:B, 7ms6:A, 7ms7:A, 7ms7:B, 6nft:A, 6nft:B, 6p9g:A |
9 | 3e78:A | 365 | 55 | 0.1928 | 0.0438 | 0.2909 | 5.8 | 3e79:A, 3eki:A |
10 | 4myp:A | 121 | 27 | 0.1205 | 0.0826 | 0.3704 | 8.1 | 4myp:B |
11 | 5c0q:B | 457 | 22 | 0.1084 | 0.0197 | 0.4091 | 10.0 | 5c0q:A, 5c0q:C, 5c0q:D |