LSYQSHDCSGACLGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTY
VQLARNY
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hfp:C | 87 | 87 | 1.0000 | 1.0000 | 1.0000 | 5.46e-62 | 8hfp:D |
2 | 7fhj:B | 107 | 68 | 0.1954 | 0.1589 | 0.2500 | 0.003 | 7mwh:B, 7mwl:B |
3 | 3vxv:A | 65 | 61 | 0.1609 | 0.2154 | 0.2295 | 0.42 | 3vxx:A, 3vyb:A, 3vyq:A, 3vyq:D |
4 | 8ouw:6 | 707 | 20 | 0.1034 | 0.0127 | 0.4500 | 4.5 | |
5 | 3ihp:B | 681 | 32 | 0.1379 | 0.0176 | 0.3750 | 6.0 | 6dxh:A, 6dxt:A, 6dxt:B, 2g43:A, 2g43:B, 2g45:A, 2g45:D, 3ihp:A, 7ms5:A, 7ms5:B, 7ms6:A, 7ms7:A, 7ms7:B, 6nft:A, 6nft:B, 6p9g:A |
6 | 3nk3:A | 284 | 14 | 0.0920 | 0.0282 | 0.5714 | 6.0 | 3nk3:B, 3nk4:A, 3nk4:B |
7 | 3e78:A | 365 | 55 | 0.1839 | 0.0438 | 0.2909 | 7.0 | 3e79:A, 3eki:A |