LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRK
IYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1odh:A | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 5.53e-119 | |
2 | 8gw5:A | 99 | 46 | 0.0892 | 0.1414 | 0.3043 | 1.3 | 7ym1:A |
3 | 4d0g:A | 167 | 52 | 0.1019 | 0.0958 | 0.3077 | 3.6 | 4drz:A, 1z0f:A |
4 | 8txo:J | 1162 | 49 | 0.1019 | 0.0138 | 0.3265 | 7.1 | |
5 | 7z4a:N | 228 | 30 | 0.1019 | 0.0702 | 0.5333 | 9.8 | 7z4a:A |