LSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKE
AYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEE
FDFVLSLEEKEP
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5j3e:A | 172 | 172 | 1.0000 | 1.0000 | 1.0000 | 1.16e-130 | 5j3e:B |
2 | 8gth:E | 105 | 38 | 0.0698 | 0.1143 | 0.3158 | 0.033 | 8gth:A, 8gth:B, 8gth:C, 8gth:F, 8gth:D |
3 | 3upt:A | 671 | 94 | 0.1337 | 0.0343 | 0.2447 | 0.12 | 3upt:B |
4 | 7vex:A | 412 | 32 | 0.0756 | 0.0316 | 0.4062 | 1.2 | 8h4m:A |
5 | 2cf5:A | 352 | 56 | 0.0988 | 0.0483 | 0.3036 | 2.1 | 2cf6:A |
6 | 1gc5:A | 467 | 66 | 0.1047 | 0.0385 | 0.2727 | 3.5 | 4b8s:A |
7 | 5o5z:A | 454 | 66 | 0.1047 | 0.0396 | 0.2727 | 4.1 | 5o5y:B, 5o5z:B |
8 | 1dot:A | 686 | 28 | 0.0698 | 0.0175 | 0.4286 | 5.2 | 1gv8:A, 1gvc:A, 1ovb:A |
9 | 3anx:B | 313 | 82 | 0.1337 | 0.0735 | 0.2805 | 9.8 | 3anx:A |