LSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAK
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6akl:A | 52 | 47 | 1.0000 | 0.9038 | 1.0000 | 6.40e-28 | 6akl:B |
2 | 8wwu:B | 492 | 24 | 0.2553 | 0.0244 | 0.5000 | 0.50 | 8wwu:A, 8wwu:C, 8wwu:D, 8wwu:E, 8wwu:F, 8wwv:A, 8wwv:B, 8wwv:C, 8wwv:D, 8wwv:E, 8wwv:F, 8x6z:A, 8x6z:B, 8x6z:C, 8x6z:D, 8x6z:E, 8x6z:F |
3 | 6pw5:A | 734 | 31 | 0.2340 | 0.0150 | 0.3548 | 4.7 | 6pw5:C |
4 | 6pw5:B | 782 | 31 | 0.2340 | 0.0141 | 0.3548 | 5.1 | 6pw5:D |
5 | 6pw4:A | 696 | 31 | 0.2340 | 0.0158 | 0.3548 | 5.5 | 6pw4:C |
6 | 5bxa:A | 414 | 41 | 0.3191 | 0.0362 | 0.3659 | 6.4 | |
7 | 6pw4:B | 675 | 31 | 0.2340 | 0.0163 | 0.3548 | 7.5 | 6pw4:D |