LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEK
TKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLA
AYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS
The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tho:A | 220 | 210 | 1.0000 | 0.9545 | 1.0000 | 8.04e-159 | 2btw:A, 2btw:B, 2bu3:A, 2bu3:B, 6th5:A, 6th5:B, 6tho:B, 6tjl:A, 6tjl:B |
2 | 6cq2:A | 688 | 103 | 0.1429 | 0.0436 | 0.2913 | 1.5 | 6cqi:A |
3 | 6rxt:US | 451 | 46 | 0.0810 | 0.0377 | 0.3696 | 2.0 | 6rxu:US, 6rxv:US, 6rxy:US, 6rxz:US |
4 | 1ebd:A | 455 | 52 | 0.0857 | 0.0396 | 0.3462 | 2.4 | 1ebd:B |
5 | 6muk:A | 363 | 28 | 0.0524 | 0.0303 | 0.3929 | 2.5 | |
6 | 7xcm:A | 494 | 118 | 0.1429 | 0.0607 | 0.2542 | 2.7 | 7xcm:B, 7xcm:C, 7xcm:D, 7xcm:E, 7xcm:F, 7xcn:A, 7xcn:B, 7xcn:C, 7xcn:D, 7xcn:E, 7xcn:F |
7 | 5wxu:B | 400 | 67 | 0.1095 | 0.0575 | 0.3433 | 3.3 | 5wxu:A, 5wxu:D, 5wxu:F, 5wxu:C, 5wxu:E |
8 | 7wwp:A | 420 | 42 | 0.0714 | 0.0357 | 0.3571 | 3.9 | 7wwq:A |
9 | 6pcm:A | 793 | 124 | 0.1667 | 0.0441 | 0.2823 | 4.2 | 6pcm:B |
10 | 5mqr:A | 1082 | 85 | 0.0952 | 0.0185 | 0.2353 | 4.4 | 5mqs:A |
11 | 6agm:A | 334 | 57 | 0.0810 | 0.0509 | 0.2982 | 5.3 | 6agm:B, 6agm:C, 6agm:D |
12 | 7obb:A | 1510 | 69 | 0.0952 | 0.0132 | 0.2899 | 5.6 | |
13 | 7ob9:A | 1535 | 69 | 0.0952 | 0.0130 | 0.2899 | 5.7 | 7oba:A |
14 | 7vbc:A | 1477 | 69 | 0.0952 | 0.0135 | 0.2899 | 5.8 | 7vba:A, 7vbb:A |
15 | 5og1:A | 819 | 81 | 0.1095 | 0.0281 | 0.2840 | 6.8 | 5ofo:C, 5ofo:F, 5ofo:E, 5ofo:D, 5ofo:B, 5ofo:A, 5og1:E, 6rn2:A, 6rn2:B, 6rn2:C, 6rn2:D, 6rn2:F, 6rn2:E, 6rn3:A, 6rn3:B, 6rn3:C, 6rn3:D, 6rn3:E, 6rn4:B, 6rn4:C, 6rn4:D, 6rn4:E |
16 | 7e7q:A | 1958 | 64 | 0.0857 | 0.0092 | 0.2812 | 8.0 | |
17 | 8czq:A | 655 | 61 | 0.0952 | 0.0305 | 0.3279 | 8.8 | |
18 | 8q5t:A | 280 | 51 | 0.0810 | 0.0607 | 0.3333 | 9.6 | 8q50:A, 8q5t:B, 8q5t:C, 8q5t:D, 8q5v:A, 8q5v:B, 8q5v:C, 8q5v:D, 8q5v:E, 8q5v:F, 8q5v:G, 8q5v:H, 8q5v:J, 8q5v:K, 8q5v:L, 8q5v:M |
19 | 7wao:A | 502 | 52 | 0.0810 | 0.0339 | 0.3269 | 10.0 | 7waj:A, 7wak:A, 7wal:A |