LSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTASYRTFNEFFVRPLRDEVRPIDTDPNVLV
MPADGVISQLGKIEEDKILQAKGHNYSLEALLAGNYLMADLFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLFS
VNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGIIKRWTWPAGENDGSVALLKGQE
MGRFKLG
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7cny:A | 253 | 247 | 1.0000 | 0.9763 | 1.0000 | 0.0 | 7cny:C |
2 | 4ccz:A | 611 | 97 | 0.0891 | 0.0360 | 0.2268 | 0.87 | |
3 | 5eiy:B | 658 | 32 | 0.0486 | 0.0182 | 0.3750 | 3.1 | 5ej1:B, 5ejz:B, 4hg6:B, 4p00:B, 4p02:B |
4 | 6xu6:DA | 350 | 120 | 0.1134 | 0.0800 | 0.2333 | 9.9 |