BioLiP

>protein
LSKGENVPYTFQDEQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKAAAAAAAAAAAAA
AAAGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSENND
MDNNNDGVDELNKKCTFWDAISKLYYVQ

The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6g90:U	196	196	1.0000	0.9592	0.9592	6.72e-138	7oqb:U, 7oqe:U
2	7dco:v	207	188	0.9149	0.8309	0.9149	2.08e-126	5gm6:I, 5zwm:v, 5zwo:v
3	5nrl:U	196	196	0.9202	0.8827	0.8827	6.79e-118
4	8i0r:v	173	136	0.2181	0.2370	0.3015	1.66e-10	7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B
5	8ch6:I	185	173	0.2447	0.2486	0.2659	3.61e-09	7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v
6	8idf:A	459	27	0.0585	0.0240	0.4074	1.0
7	1zu1:A	127	72	0.1117	0.1654	0.2917	1.2
8	6iw6:A	438	79	0.1011	0.0434	0.2405	1.4	6iw6:B
9	5kd2:A	591	68	0.0904	0.0288	0.2500	1.4	5kd5:A, 5kd8:A
10	8ost:A	390	79	0.1011	0.0487	0.2405	1.7
11	8oki:B	1101	39	0.0798	0.0136	0.3846	4.2	8cro:B, 8orq:B, 8p2i:B, 8rbo:B
12	5cqx:B	116	61	0.0851	0.1379	0.2623	7.8	5cqx:A, 5cqy:A, 5cqy:B, 5cr2:A, 5cr2:B, 5cr2:C
13	6hif:G	531	18	0.0532	0.0188	0.5556	8.5	6hif:I, 6hif:H, 6hif:A, 6hif:C, 6hif:B, 6hif:D, 6hif:F, 6hif:E, 6hif:J, 6hif:L, 6hif:K, 6hif:M, 6hif:O, 6hif:N, 6hif:P, 6hif:R, 6hif:Q, 6hif:S, 6hif:U, 6hif:T, 6hif:V, 6hif:X, 6hif:W

[Back]