LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bad:A | 58 | 58 | 1.0000 | 1.0000 | 1.0000 | 3.14e-38 | |
2 | 6ha4:A | 55 | 55 | 0.3276 | 0.3455 | 0.3455 | 3.01e-05 | 6hah:A, 6haj:A, 6haj:B |
3 | 6fqy:A | 468 | 34 | 0.1552 | 0.0192 | 0.2647 | 6.4 | 6fqy:B, 6fqz:A, 6fqz:B |