LSGRLNWQALAGLKASGAEQNLYNVFNAVFEGTKYVLYEKPKHLKNLYAQVVLPDDVIKEIFNPLIDLSTTQWGVSPAFA
IENTETHKILFGEIKRQDGWVEGKDPSAGRGNAHERSCKLFTPGLLKAYRTIGGINDEEILPFWVVFEGDITRDPKRVRE
ITFWYDHYQDNYFMWRPNESGEKLVQHFNEKLKKYLD
The query sequence (length=197) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1d02:B | 200 | 197 | 1.0000 | 0.9850 | 1.0000 | 1.72e-148 | 1d02:A |
2 | 3q5i:A | 470 | 161 | 0.1574 | 0.0660 | 0.1925 | 0.98 | |
3 | 3vkg:B | 2853 | 65 | 0.1117 | 0.0077 | 0.3385 | 1.3 | |
4 | 3vkh:B | 2908 | 65 | 0.1117 | 0.0076 | 0.3385 | 1.3 | |
5 | 3vkg:A | 2954 | 65 | 0.1117 | 0.0074 | 0.3385 | 1.4 | |
6 | 3vkh:A | 3042 | 65 | 0.1117 | 0.0072 | 0.3385 | 1.4 | |
7 | 3x2t:A | 311 | 48 | 0.0964 | 0.0611 | 0.3958 | 5.5 | 2kin:A, 3kin:A, 3kin:C |
8 | 3mq4:A | 386 | 69 | 0.1371 | 0.0699 | 0.3913 | 8.0 |