Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
LRVDPIVPAISFVGWTLPSNIGTSALNGQSLFGAFYESIGQNLAHWPTGFALDDKFWLYMVTWHTGLFIVMLLGQVGFKG
RTEDYF

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6sl5:O 86 86 1.0000 1.0000 1.0000 5.78e-60
2 7dz7:O 97 85 0.6047 0.5361 0.6118 7.33e-37 7d0j:O, 7dz8:O
3 8j6z:O 86 84 0.5349 0.5349 0.5476 5.06e-26
4 8wgh:O 89 86 0.5349 0.5169 0.5349 1.17e-25
5 8htu:O 90 86 0.5349 0.5111 0.5349 8.27e-25 7ksq:O, 7ku5:O, 7xqp:O
6 6zzx:O 87 82 0.4535 0.4483 0.4756 1.51e-23
7 7yca:O 96 77 0.4302 0.3854 0.4805 1.29e-21
8 7y5e:ON 92 80 0.3837 0.3587 0.4125 3.15e-17 7y5e:O2, 7y7a:O7, 7y7a:Oo
9 6fos:O 98 85 0.4070 0.3571 0.4118 6.53e-17 7blz:O, 8wey:O, 5zgb:O, 5zgh:O
10 8wm6:O 104 78 0.3837 0.3173 0.4231 2.54e-16 8wmv:O, 8wmw:O
11 5zji:O 76 86 0.4302 0.4868 0.4302 2.61e-15
12 7y7b:O 99 82 0.3721 0.3232 0.3902 6.79e-14 7y8a:O
13 1n7d:A 639 51 0.1860 0.0250 0.3137 0.006 1ajj:A, 3bps:E, 1d2j:A, 1f8z:A, 2fcw:B, 3gcw:E, 3gcx:E, 1hj7:A, 1hz8:A, 1i0u:A, 2kri:B, 2lgp:A, 3m0c:C, 3p5b:L, 3p5c:L, 1xfe:A
14 2c8s:A 149 80 0.2791 0.1611 0.3000 0.026
15 5meh:A 438 61 0.2209 0.0434 0.3115 0.20 4ayp:A, 4ayq:A, 4ayr:A, 8b5m:A, 5ne5:A
16 6hwh:V 550 43 0.1860 0.0291 0.3721 0.83 6hwh:Q
17 4cot:A 443 56 0.1860 0.0361 0.2857 2.1 2x8s:A, 2x8s:B
18 8jib:E 661 41 0.1512 0.0197 0.3171 3.2 8ji8:A, 8ji8:B, 8ji8:C, 8ji8:D, 8jib:A, 8jib:B, 8jib:C, 8jib:D, 8jib:F, 8jib:G, 8jib:H, 8jib:I, 8jib:J, 8jib:K, 8jib:L
19 6adq:F 552 43 0.1744 0.0272 0.3488 4.3 6adq:R, 7e1v:F, 7e1v:R, 7e1w:F, 7e1w:R, 7e1x:F, 7e1x:R, 8hcr:F, 8hcr:R, 8ovc:R, 8ovc:L, 8ovd:R, 8ovd:L, 7rh5:R, 7rh5:L, 7rh6:R, 7rh6:L, 7rh7:R, 7rh7:L
20 7ago:A 214 58 0.1744 0.0701 0.2586 5.5 7agl:A
21 8ovw:N 391 48 0.1860 0.0409 0.3333 7.1 8ow1:N

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218