BioLiP

>protein
LRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR

The query sequence (length=45) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7l08:A3	72	45	1.0000	0.6250	1.0000	2.36e-26	7a5f:d6, 7a5g:d6, 7a5i:d6, 7a5k:d6, 8any:A3, 8csq:3, 8csr:3, 8css:3, 8cst:3, 8csu:3, 3j9m:A3, 8k2a:Sn, 6nu2:A3, 6nu3:A3, 7og4:A3, 8oir:AD, 8ois:AD, 7p2e:3, 7pnx:3, 7pny:3, 7pnz:3, 7po0:3, 7po1:3, 7po2:3, 7po3:3, 7qi4:A3, 7qi5:A3, 7qi6:A3, 8qrk:3, 8qrl:3, 8qrm:3, 8qrn:3, 6rw4:3, 6rw5:3, 6vlz:A3, 6vmi:A3, 8xt0:Sn, 8xt2:Sn, 6zm5:A3, 6zm6:A3, 6zs9:A3, 6zsa:A3, 6zsb:A3, 6zsc:A3, 6zsd:A3, 6zse:A3, 6zsg:A3
2	7pnv:3	72	45	0.8667	0.5417	0.8667	3.46e-23	7pnt:3, 7pnu:3, 7pnw:3
3	5aj3:n	72	45	0.8222	0.5139	0.8222	1.21e-21	5aj4:An, 6gaw:An, 6gaz:An, 7nqh:An, 7nql:An, 7nsi:An, 7nsj:An, 8oin:AD, 8oip:AD, 6ydp:An, 6ydw:An
4	3jd5:n	72	45	0.8222	0.5139	0.8222	5.05e-21	6neq:n, 6nf8:n
5	7nvm:H	528	42	0.2889	0.0246	0.3095	0.90	8i1u:G, 8i1u:O, 7nvl:H, 7nvl:h, 7nvm:h, 7nvn:H, 7nvn:h, 8sfe:h, 8sfe:H, 8sff:H, 8sff:h, 8sg8:H, 8sg8:h, 8sg9:H, 8sg9:h, 8sgc:H, 8sgc:h, 8sgl:H, 8sgl:h, 8sgq:h, 8sgq:H, 8sh9:H, 8sh9:h, 8sha:H, 8sha:h, 8shd:H, 8shd:h, 8she:H, 8she:h, 8shf:H, 8shf:h, 8shg:H, 8shg:h, 8shl:H, 8shl:h, 8shn:H, 8shn:h, 8sho:H, 8sho:h, 8shp:H, 8shp:h, 8shq:H, 8shq:h, 8sht:H, 8sht:h, 7trg:C, 7ttn:C, 7ttt:C, 7tub:C, 7x0s:H, 7x0s:O, 7x0v:H, 7x0v:O, 7x3j:H, 7x3j:h, 7x3u:h, 7x3u:H
6	8v46:A	412	31	0.2889	0.0316	0.4194	1.8	8ux9:B, 8ux9:C, 8v46:B, 8v47:A, 8v47:B, 8v47:C, 8v48:A, 8v48:B, 8v48:C, 8v48:F, 8v49:A, 8v49:B
7	6m5x:O	334	22	0.2222	0.0299	0.4545	4.0	6m5x:R, 6m5x:P, 6m5x:Q
8	8art:B	393	20	0.2000	0.0229	0.4500	6.6	8art:A
9	3uyy:B	337	14	0.1778	0.0237	0.5714	6.6	3uyy:A, 3uzb:A, 3uzb:B, 3uzb:C, 3uzb:D, 3uzo:A, 3uzo:B
10	7sx3:A	1386	21	0.2222	0.0072	0.4762	6.6	7sx4:A
11	3a9v:A	528	24	0.1778	0.0152	0.3333	7.8	3ni2:A
12	4bf7:A	335	42	0.2444	0.0328	0.2619	8.9
13	4a37:B	376	19	0.1778	0.0213	0.4211	9.1	4a37:A, 4a38:A, 4a38:B, 4a39:A, 4a39:B

[Back]