BioLiP

>protein
LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADPIKCSAPKYIDYLMTWVQDQL
DDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQE
LIEKLG

The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5brk:A	194	168	1.0000	0.8557	0.9881	2.30e-124	5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B
2	2hjn:A	206	168	0.5602	0.4515	0.5536	6.94e-63	5ncn:A
3	5ncm:A	183	165	0.4398	0.3989	0.4424	2.26e-50
4	7k36:H	177	149	0.2048	0.1921	0.2282	1.22e-04
5	5yf4:A	129	143	0.1747	0.2248	0.2028	0.91
6	5elk:A	121	60	0.1024	0.1405	0.2833	1.3
7	1rv3:B	466	60	0.0843	0.0300	0.2333	5.8	1cj0:A, 1ls3:A, 1ls3:B, 1ls3:C, 1ls3:D, 1rv3:A, 1rv4:A, 1rv4:B, 1rvu:A, 1rvu:B, 1rvy:A, 1rvy:B
8	8ep6:A	245	33	0.0542	0.0367	0.2727	7.2
9	2vea:A	500	42	0.0783	0.0260	0.3095	7.9
10	7orm:A	2145	62	0.1084	0.0084	0.2903	8.6
11	6c0f:D	190	129	0.1687	0.1474	0.2171	9.7	6cb1:D, 8e5t:D, 6em1:3, 6em3:3, 6em4:3, 6em5:3, 7ohs:3, 7ohw:3, 7ohx:3, 8v83:R, 8v84:R, 5z3g:Z

[Back]