BioLiP

>protein
LRETESWKLLESSIIYYEGNPIGTVAAQDPEQCFLRDFVPSAFVFLMDGQTDIVRNFLIETLTLQSHEKEMDCFQPGAGL
MPASFKVESEYLVADFGEKAIARVPPVDSCMWWILLLRAYEKATGDLTLAREPKFQAGIKLILDLCLAHRFSMYPTMLVP
DGAFMIDRRMGVYEHPLEIQVLFYAALRAARELLLPDGDGEQYLNKVHGRLGALQYHIRNYYWVDLKRLREIYRYKGNEF
GKEIANKFNIFSQSIPDWVIEWLPEKGGYLAGNLGPGRMDFRFFALGNLMAILAGLASEEESQRIMNLFAHRWEDLIGYM
PVKICYPALQGLEWQIVTGCDPKNIPWSYHNGGNWPVLLWLFTAAALKTGKVELAHEAIAIAEGRLSNDKFPEYYDGNNG
RLIGKEARIYQTWSIAGLLVAKQFLANPDHVEFIS

The query sequence (length=435) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5goo:A	447	446	1.0000	0.9732	0.9753	0.0	5goo:B, 5goo:C, 5gop:A, 5gop:C, 5gop:B, 5goq:A, 5goq:B, 5goq:C
2	5z74:A	441	439	0.6184	0.6100	0.6128	0.0	5z74:B
3	6g3n:A	445	74	0.0529	0.0517	0.3108	0.087	6g3n:B, 5ohz:A, 5ohz:B, 5ohz:C, 5ohz:D, 5oi0:A, 5oi0:B, 5oi1:A, 5oi1:B, 5oie:A, 5oie:B, 5oiv:A, 5oiv:B, 5oiw:A, 5oiw:B, 5oj4:A, 5oj4:B, 5oju:A, 5oju:B, 5ojv:A, 5ojv:B, 5ont:A, 5ont:B, 5onz:A, 5onz:B, 5oo2:A, 5oo2:B
4	4o5t:B	326	94	0.0506	0.0675	0.2340	1.1	4o5t:A, 7zp7:A, 7zp7:B
5	2e9l:A	466	56	0.0391	0.0365	0.3036	1.3	2e9m:A, 3vkk:A, 2zox:A
6	4zlf:A	785	34	0.0276	0.0153	0.3529	8.5	4zlg:A, 4zli:A
7	2eqd:A	510	93	0.0575	0.0490	0.2688	9.6	2e0p:A, 2e4t:A, 2eex:A, 2ej1:A, 2eo7:A

[Back]