LQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVI
RLPYNVAKDAEISGKYENGVLTIRIPIA
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vqm:A | 111 | 108 | 1.0000 | 0.9730 | 1.0000 | 9.36e-74 | 3vqm:B, 3vqm:C, 3vqm:E, 3vqm:F, 3vqm:I, 3vqm:K, 3vqm:M, 3vqm:N |
2 | 4yl9:D | 123 | 105 | 0.6667 | 0.5854 | 0.6857 | 2.30e-47 | |
3 | 5zs3:A | 113 | 93 | 0.2685 | 0.2566 | 0.3118 | 2.37e-06 | 5zs6:A |
4 | 3gla:B | 99 | 93 | 0.2593 | 0.2828 | 0.3011 | 0.012 | 3gla:A |
5 | 7oa6:B | 152 | 64 | 0.1759 | 0.1250 | 0.2969 | 2.1 | 7oa6:I |
6 | 7smk:A | 455 | 27 | 0.0926 | 0.0220 | 0.3704 | 2.2 | 7snv:A |
7 | 3atg:A | 242 | 43 | 0.1204 | 0.0537 | 0.3023 | 2.2 | |
8 | 8cmy:C | 445 | 27 | 0.0926 | 0.0225 | 0.3704 | 3.6 | 8cmy:M, 8cmy:G, 8cmy:I, 8cmy:K, 8cmy:O, 7yyo:A, 7yyo:C, 7yyo:E, 7yyo:G, 7yyo:I, 7yyo:K, 7yyo:M, 7yyo:O |
9 | 3aek:A | 415 | 33 | 0.1204 | 0.0313 | 0.3939 | 7.1 | 3aek:C, 3aeq:A, 3aeq:C, 3aer:A, 3aer:C, 3aes:A, 3aes:C, 3aet:A, 3aet:C, 3aeu:A, 3aeu:C |