LQCYNCPNPTADCKTAVNCSSAFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5imt:D | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 1.19e-52 | |
2 | 6fx7:A | 194 | 33 | 0.1429 | 0.0567 | 0.3333 | 0.70 | 2bfq:A, 2bfr:A, 7wr6:B |
3 | 1zxv:A | 728 | 31 | 0.1558 | 0.0165 | 0.3871 | 1.5 | 1j7n:A, 4pkw:A, 1pww:A |
4 | 1jky:A | 748 | 31 | 0.1558 | 0.0160 | 0.3871 | 1.5 | 5d1s:A, 5d1t:A, 5d1u:A, 4dv8:A, 1j7n:B, 4pkq:A, 4pkr:A, 4pks:A, 4pkt:A, 4pku:A, 4pkv:A, 1pwp:A, 1pwp:B, 1pwq:A, 1pwq:B, 1pwu:A, 1pwu:B, 1pwv:A, 1pwv:B, 1pww:B, 4wf6:A, 4xm6:A, 4xm7:A, 4xm8:A, 1yqy:A, 1zxv:B |
5 | 4lim:A | 381 | 27 | 0.1558 | 0.0315 | 0.4444 | 4.6 | |
6 | 3cfd:H | 220 | 27 | 0.1429 | 0.0500 | 0.4074 | 6.5 | 1cf8:H, 3cfd:B |
7 | 7qv7:A | 174 | 63 | 0.2338 | 0.1034 | 0.2857 | 8.1 | 7qv7:G |