LPDLSGRLLINSVFHMGAERLQQMLFSDSPFLQGFLQQRKFTDVTLSPWSSDSKCHQRRVLTYTIPIKSASVVETQTLFR
RGPQAGGCVVDSEVLTQGIPYQDYFYTAHRYCILGLARNKARLRVSSEIRYRKQPWSLVKSLIEKNSWSGIEDYFHHLDR
ELAKAEK
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gqf:A | 168 | 172 | 0.9641 | 0.9583 | 0.9360 | 5.07e-115 | 6gqf:B, 6gqf:C, 6gqf:D |
2 | 7azn:A | 177 | 167 | 0.4910 | 0.4633 | 0.4910 | 7.58e-56 | 8axw:A |
3 | 2c1c:A | 312 | 53 | 0.0838 | 0.0449 | 0.2642 | 0.42 | 2c1c:B |
4 | 3s6t:A | 575 | 39 | 0.0539 | 0.0157 | 0.2308 | 2.5 | 3nsn:A, 3ozo:A, 3ozp:A, 3vtr:A, 3wmb:A, 3wmc:A, 5y0v:A, 5y1b:A |
5 | 6cay:A | 165 | 173 | 0.1976 | 0.2000 | 0.1908 | 3.1 | 6cay:B |
6 | 2qlw:B | 108 | 42 | 0.0958 | 0.1481 | 0.3810 | 3.1 | 2qlx:A, 2qlx:B |
7 | 6k35:A | 640 | 29 | 0.0599 | 0.0156 | 0.3448 | 5.2 | 6k35:B |
8 | 3b47:A | 121 | 54 | 0.0838 | 0.1157 | 0.2593 | 7.3 | |
9 | 6s8w:B | 491 | 39 | 0.0838 | 0.0285 | 0.3590 | 9.8 | 6s8w:A, 6s8w:D |