LNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEI
SLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGL
GEGFQTVRVGTVGTPVGTITLSCAYRINLA
The query sequence (length=190) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8do8:B | 192 | 190 | 1.0000 | 0.9896 | 1.0000 | 1.19e-141 | 5c50:B, 8do8:D |
2 | 8rpr:A | 338 | 78 | 0.1263 | 0.0710 | 0.3077 | 2.6 | 8ftr:A, 8fts:A, 8ftv:A, 8rww:A, 8rxf:A, 8rxg:A |