LNLTKEQHEWLNGWLELWGAWVYSGRLEKRMSSVIAKFMESVEPGRVMTRPMCNDDDGMLISQVVDSVMYIDKKAFGILL
SYYAHGSSKHAIASYYHRVARPRKMLCRGGGRIQKPSLATCRREVDEILNASLFMIYPVLDSAFK
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6p18:Q | 156 | 144 | 0.9931 | 0.9231 | 1.0000 | 6.53e-108 | 6jnx:P, 6jnx:Q, 6p18:P, 6p1a:A, 6p1a:B, 6p1a:C |
2 | 6p19:Q | 139 | 144 | 0.8759 | 0.9137 | 0.8819 | 1.94e-89 | |
3 | 2d0o:A | 606 | 46 | 0.1103 | 0.0264 | 0.3478 | 0.61 | 2d0o:C, 2d0p:A, 2d0p:C |
4 | 1px8:A | 500 | 38 | 0.0690 | 0.0200 | 0.2632 | 2.5 | 1px8:B, 1uhv:A, 1uhv:B, 1uhv:C, 1uhv:D |
5 | 7yyl:E | 243 | 45 | 0.0897 | 0.0535 | 0.2889 | 5.9 | 7yyl:F, 7yyl:G, 7yyl:H, 7yzm:G, 7yzm:H, 7yzm:E, 7yzm:F, 7yzq:E, 7yzq:F, 7yzq:G, 7yzq:H |