BioLiP

>protein
LLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHG
VLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAV
LTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNF
IMKSEDYLSSISE

The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3w68:C	252	250	0.9881	0.9921	1.0000	0.0
2	1oiz:A	265	251	0.9051	0.8642	0.9124	8.60e-168	5mue:A, 5mug:A, 1oip:A, 1oiz:B, 1r5l:A, 3w67:A, 3w67:B, 3w67:C, 3w67:D, 3w68:A, 3w68:B, 3w68:D, 6zpd:A
3	4ciz:A	284	209	0.2648	0.2359	0.3206	7.15e-39	4cj6:A, 3hx3:A, 3hy5:A
4	1olm:E	397	235	0.2767	0.1763	0.2979	1.51e-21	1olm:A, 1olm:C, 4omj:A, 4omj:B, 4omk:A, 4omk:B
5	4tlg:A	396	241	0.2727	0.1742	0.2863	3.38e-21	4tlg:B
6	6f0e:A	300	247	0.2609	0.2200	0.2672	1.65e-16	7zg9:A, 7zg9:B, 7zga:A, 7zgb:A, 7zgc:A, 7zgd:A
7	3b7n:A	307	229	0.2292	0.1889	0.2533	4.49e-12	3b7z:A, 6sld:A
8	7y10:A	291	221	0.2213	0.1924	0.2534	2.43e-09	7y10:B, 7y11:A, 7y11:B
9	6w32:B	288	211	0.1581	0.1389	0.1896	0.003	6w32:A, 6w32:C
10	7wvt:A	364	215	0.1739	0.1209	0.2047	0.22	7wwd:A, 7wwg:A
11	7pkt:r	158	38	0.0593	0.0949	0.3947	6.1
12	1xhf:B	122	27	0.0474	0.0984	0.4444	9.3	1xhf:A

[Back]