LLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCDLTMETRDHQEFYYAKVTAVSAGG
PPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQ
REYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPD
The query sequence (length=201) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6weo:7 | 201 | 201 | 1.0000 | 1.0000 | 1.0000 | 1.55e-152 | 6weo:F, 6weo:M, 6weo:V |
2 | 3dgc:R | 202 | 201 | 0.7910 | 0.7871 | 0.7910 | 2.50e-119 | |
3 | 3ela:T | 191 | 153 | 0.2090 | 0.2199 | 0.2745 | 1.03e-04 | |
4 | 6weo:O | 196 | 146 | 0.1542 | 0.1582 | 0.2123 | 0.024 | 6weo:K, 6weo:C |
5 | 6e3k:E | 213 | 68 | 0.1095 | 0.1033 | 0.3235 | 0.031 | 6e3k:I, 6e3l:E, 6e3l:I, 5eh1:A |
6 | 6wqz:C | 536 | 132 | 0.1692 | 0.0634 | 0.2576 | 0.26 | 6wqz:B, 6wqz:A, 6wr4:A, 6wr4:B, 6wr4:C |
7 | 8u41:B | 451 | 55 | 0.0846 | 0.0377 | 0.3091 | 0.53 | 8u41:A, 8u42:A, 8u42:B, 8ux5:A, 8ux5:B |
8 | 2c1g:A | 384 | 89 | 0.1144 | 0.0599 | 0.2584 | 5.2 | 2c1i:A |