BioLiP

>protein
LLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKY
ADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLI
PIFEELSGAEDVYTSLGQLRA

The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2q5e:A	181	181	1.0000	1.0000	1.0000	3.92e-134	2q5e:B, 2q5e:C, 2q5e:D, 2q5e:E, 2q5e:F, 2q5e:G, 2q5e:H
2	1t9z:A	181	178	0.7569	0.7569	0.7697	7.57e-105	6du2:A, 6du2:B, 6du3:A, 6du3:B, 2ghq:A, 2ghq:B, 2ght:A, 2ght:B, 3l0b:A, 3l0c:A, 3l0c:B, 3l0y:A, 3l0y:B, 3pgl:A, 3pgl:B, 1ta0:A, 4ygy:A, 4ygy:B, 4yh1:A, 4yh1:B
3	2hhl:C	184	167	0.7845	0.7717	0.8503	3.17e-103	2hhl:A, 2hhl:D
4	8ujm:B	237	172	0.4033	0.3080	0.4244	5.91e-42	8ujm:A
5	4qqf:F	191	158	0.3149	0.2984	0.3608	1.37e-28	3qle:A
6	3ef1:A	372	108	0.1492	0.0726	0.2500	2.77e-06	3ef0:A, 4xpz:A, 4xq0:A
7	4avn:A	420	54	0.1050	0.0452	0.3519	0.30	4avo:A, 4b4f:A, 4b4f:B
8	2zu8:A	373	54	0.0829	0.0402	0.2778	0.70	2zu8:B, 2zu9:B, 2zu9:A
9	2ilu:A	477	139	0.1934	0.0734	0.2518	0.73	2imp:A, 2opx:A
10	3shq:A	299	178	0.2210	0.1338	0.2247	0.86
11	1u1h:A	746	96	0.1436	0.0349	0.2708	1.5	1u1j:A, 1u1u:A, 1u22:A
12	6h3o:F	650	74	0.1160	0.0323	0.2838	2.8	6h3g:A, 6h3g:B, 6h3g:C, 6h3g:F, 6h3g:D, 6h3g:E, 6h3g:G, 6h3g:H, 6h3o:A, 6h3o:B, 6h3o:C, 6h3o:D, 6h3o:E, 6h3o:G, 6h3o:H, 8il5:A
13	3o8o:E	752	24	0.0608	0.0146	0.4583	3.7	3o8o:A, 3o8o:C, 3o8o:G
14	2lcq:A	161	74	0.1326	0.1491	0.3243	5.3
15	6a30:A	527	98	0.1381	0.0474	0.2551	5.6
16	5ave:A	252	70	0.1160	0.0833	0.3000	7.7	5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B

[Back]