BioLiP

>protein
LLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1wj2:A	71	63	1.0000	0.8873	1.0000	2.70e-43	2lex:A
2	8k31:B	79	62	0.8095	0.6456	0.8226	6.32e-34
3	2ayd:A	76	62	0.6825	0.5658	0.6935	1.98e-31
4	8iex:A	88	61	0.5873	0.4205	0.6066	5.46e-22
5	7z0r:A	81	59	0.5238	0.4074	0.5593	9.75e-22	7z0r:B, 7z0u:A
6	6j4f:B	63	60	0.5556	0.5556	0.5833	2.28e-19	6j4f:F
7	7d11:A	79	62	0.5238	0.4177	0.5323	3.75e-19	6j4e:B
8	6j4g:B	58	59	0.5238	0.5690	0.5593	6.34e-17
9	5w3x:D	73	68	0.4603	0.3973	0.4265	3.97e-14	7p8k:B, 5w3x:B
10	6ir8:A	69	59	0.3810	0.3478	0.4068	6.97e-12
11	6nwz:A	665	21	0.1429	0.0135	0.4286	1.1
12	8j62:C	127	37	0.2063	0.1024	0.3514	1.6	8e40:B, 8j62:G
13	4n9f:b	172	38	0.2063	0.0756	0.3421	2.5	8fvi:1, 8fvj:1, 8fvj:6, 8h0i:C, 8h0i:E, 8h0i:G, 8h0i:I, 8j62:E, 8j62:I, 4n9f:G, 4n9f:M, 4n9f:S, 4n9f:d, 4n9f:j, 4n9f:p, 4n9f:v, 4n9f:1, 4n9f:7, 4n9f:q, 4n9f:2
14	3chl:A	315	48	0.2222	0.0444	0.2917	3.8	3chj:A, 3chk:A
15	2z71:C	331	54	0.2540	0.0483	0.2963	5.0	2z71:A
16	6sh3:A	376	44	0.2381	0.0399	0.3409	5.1	6sh3:B, 6sh3:C, 6sh3:D, 6sh3:E, 6sh3:F, 6sh3:G
17	6r4o:A	841	44	0.2222	0.0166	0.3182	5.6
18	7cms:A	328	38	0.1429	0.0274	0.2368	8.6	7cki:A, 7cms:B, 5dk4:A, 7eer:A, 7eer:B, 7eer:C, 7eer:D, 1i6k:A, 1i6l:A, 1i6m:A, 1m83:A, 1mau:A, 1maw:A, 1maw:B, 1maw:C, 1maw:D, 1maw:E, 1maw:F, 1mb2:A, 1mb2:B, 1mb2:C, 1mb2:D, 1mb2:E, 1mb2:F, 2ov4:A
19	8qj5:A	412	25	0.1587	0.0243	0.4000	9.4
20	8ejo:A	56	31	0.1429	0.1607	0.2903	9.6	8ejo:B, 8ejp:A, 8ejp:B
21	6pv0:A	31	11	0.1270	0.2581	0.7273	9.7	6pv1:A, 6pv2:A, 6pv3:A, 1sp2:A, 6uco:A, 6ucp:A, 1va2:A

[Back]