LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVI
FDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGIN
VLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDL
QSHLIEQYNLKVTHDILERLLNYISE
The query sequence (length=266) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3jyy:B | 266 | 266 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3jyy:A, 3jz0:A, 3jz0:B |
2 | 3aln:C | 183 | 48 | 0.0602 | 0.0874 | 0.3333 | 1.0 | |
3 | 2pml:X | 340 | 99 | 0.0977 | 0.0765 | 0.2626 | 1.3 | 2pmn:X, 2pmo:X |
4 | 5vpw:B | 458 | 76 | 0.0827 | 0.0480 | 0.2895 | 9.6 | 1mio:B, 1mio:D, 5vpw:D, 5vq3:B, 5vq3:D, 4wes:B, 4wes:D, 4wn9:B, 4wn9:D |
5 | 4ebk:A | 257 | 37 | 0.0414 | 0.0428 | 0.2973 | 9.9 | 4ebk:B |