BioLiP

>protein
LKKSVLAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRIIVQMAIIASLVIVV
DQILKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSEPIPSFIDGIGNGLGYGFVLMTVGFFRELLGSGKLFGLEVL
PLISNGGWYQPNGLMLLAPSAFFLIGFMIWAIRTFKPEQVEAKE

The query sequence (length=204) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7xk7:D	206	204	1.0000	0.9903	1.0000	2.26e-147	8a1t:D, 8a1u:D, 8a1v:D, 8a1w:D, 8a1x:D, 8a1y:D, 8acw:D, 8acy:D, 8ad0:D, 8evu:D, 8ew3:D, 7xk3:D, 7xk4:D, 7xk5:D, 7xk6:D
2	7zc6:E	194	188	0.3725	0.3918	0.4043	3.91e-42
3	8ahx:E	213	196	0.3480	0.3333	0.3622	1.83e-36	8rb8:E, 8rb9:E, 8rbm:E, 8rbq:E
4	7zc6:A	191	148	0.2500	0.2670	0.3446	1.13e-13
5	8ahx:A	189	151	0.1814	0.1958	0.2450	1.39e-08	8rb8:A, 8rb9:A, 8rbm:A, 8rbq:A
6	8evu:E	198	140	0.1814	0.1869	0.2643	4.81e-07	8a1t:E, 8a1u:E, 8a1v:E, 8a1w:E, 8a1x:E, 8a1y:E, 8acw:E, 8acy:E, 8ad0:E, 8ew3:E, 7xk3:E, 7xk4:E, 7xk5:E, 7xk6:E, 7xk7:E
7	1j32:A	388	39	0.0735	0.0387	0.3846	0.007	1j32:B
8	5bnt:C	371	80	0.1078	0.0593	0.2750	1.1	5bnt:B, 5bnt:A, 5bnt:D
9	7myj:C	465	34	0.0686	0.0301	0.4118	6.1	3aqv:A, 6b1u:C, 6b2e:A, 8bik:A, 8bik:D, 5iso:A, 4zhx:C
10	4v8k:AM	319	42	0.0735	0.0470	0.3571	6.1	5b5m:M, 5b5m:y, 5b5n:M, 5b5n:y, 7c52:M, 1eys:M, 4v8k:BM, 7vrj:M, 8wdu:M, 8wdv:M, 3wmm:M, 5y5s:M
11	7dr0:F	161	59	0.0784	0.0994	0.2712	6.4	7dr1:F, 7dr2:aF, 7dr2:bF, 7dr2:cF, 7dr2:dF
12	1gd9:A	388	53	0.0588	0.0309	0.2264	7.2	1dju:A, 1dju:B, 1gd9:B, 1gde:A, 1gde:B
13	6qdj:A	758	40	0.0686	0.0185	0.3500	9.4
14	5xy3:k	68	30	0.0490	0.1471	0.3333	9.9

[Back]