BioLiP

>protein
LKHIPKNISPDLLKTLMEMGHGDEIVLADANYPSASCANKLIRCDGVNIPELLDSILYLMPLDSYVDSSIQFMNVVSGDD
IPKIWGTYRQMIEGHGTDLKTITYLRREDFYERSKKAYAIVATGETSLYANIILKKGVV

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4a34:I	142	139	1.0000	0.9789	1.0000	7.44e-102	4a34:A, 4a34:B, 4a34:C, 4a34:D, 4a34:E, 4a34:F, 4a34:G, 4a34:H, 4a34:J, 4a34:K, 4a34:O, 4a34:L, 4a34:M, 4a34:N, 4a34:P, 4a34:Q, 4a34:R, 4a34:S, 4a34:T
2	2wcu:A	149	147	0.5396	0.5034	0.5102	8.96e-44	2wcu:B
3	2wcv:B	140	139	0.4532	0.4500	0.4532	3.44e-33	2wcv:A, 2wcv:C, 2wcv:D, 2wcv:E, 2wcv:F, 2wcv:G, 2wcv:H, 2wcv:I, 2wcv:J
4	1ogd:A	131	128	0.2662	0.2824	0.2891	2.56e-08	1ogd:B, 1ogd:C, 1ogd:D, 1ogd:E, 1oge:A, 1oge:B, 1oge:C, 1oge:D, 1oge:E
5	1fg3:A	354	38	0.1151	0.0452	0.4211	1.4	1fg7:A, 1gew:A, 1gex:A, 1gey:A, 1iji:A
6	3p13:A	130	130	0.2014	0.2154	0.2154	3.2	3p13:B, 3p13:C, 3p13:D
7	2xwp:A	257	53	0.1151	0.0623	0.3019	3.8
8	7szp:A	353	38	0.1079	0.0425	0.3947	5.0	7szp:B, 7szp:C, 7szp:D
9	3c66:A	529	31	0.0791	0.0208	0.3548	5.8	3c66:B, 1fa0:A, 1fa0:B, 2q66:A
10	6yw5:ZZ	312	63	0.1151	0.0513	0.2540	6.1	6ywe:ZZ, 6ywx:ZZ, 6ywy:ZZ
11	8jc1:A	267	81	0.1511	0.0787	0.2593	6.5	8jc1:B, 8jc1:C, 8jc1:D

[Back]