LKFQSKGYNQIYDQIWRDLARKDVSKVFRLATDSYATKASNLKKTAILASKEAKRWQLRTNKGTKDLQARAKRVMRDMMG
FWKRNEREERDLRKAAERL
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a5p:G | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 1.28e-67 | 8a5q:G |
2 | 3l2p:A | 535 | 66 | 0.1919 | 0.0355 | 0.2879 | 2.0 | |
3 | 7tdg:A | 4134 | 48 | 0.1313 | 0.0031 | 0.2708 | 5.5 | 7tdg:C, 7tdg:D, 7tdg:B, 7tdi:B, 7tdi:C, 7tdi:D, 7tdi:A, 7tdj:A, 7tdj:B, 7tdj:C, 7tdj:D, 7tdk:A, 7tdk:B, 7tdk:C, 7tdk:D |
4 | 7t1h:A | 342 | 41 | 0.1616 | 0.0468 | 0.3902 | 6.1 | 7t1g:A, 7t1h:B, 7t1i:A, 6uj5:A |
5 | 2ntv:A | 268 | 36 | 0.1414 | 0.0522 | 0.3889 | 7.7 | 2ntv:B, 6q1y:A |