LIQSEEYVDLTFKLRGAPIPLDNGYLTYAALSRICPPLHELKSIGIHPIAGIPTRNNLLELTAQSRLKIRIYHQQIPLIY
PYLAGQAFHIGQNFYQLDIPDYKPLISSESVYSRLVIIKGFQDSTNFIEAVQRQMDNLGIQGKIELLTRQDGTPQRRQLT
INKEGKQFKVRGFGVKISELNPEDSLTLQEQGIGGKRKMMCGIFVPATRSKEEEET
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fcj:B | 216 | 216 | 1.0000 | 1.0000 | 1.0000 | 4.40e-160 | 8fcu:B, 8fd2:B, 8fd3:B, 8ff4:B, 8ff5:B |
2 | 3okf:A | 360 | 70 | 0.1065 | 0.0639 | 0.3286 | 0.15 | 3okf:B |
3 | 8sor:A | 1156 | 121 | 0.1389 | 0.0260 | 0.2479 | 2.7 | |
4 | 5ntd:G | 520 | 66 | 0.0880 | 0.0365 | 0.2879 | 3.0 | 4efd:F, 5nsm:A, 5nsm:B, 5nsm:C, 5nsm:D, 5nsm:E, 5nsm:F, 5nsm:G, 5nsm:H, 5nsm:I, 5nsm:J, 5nsm:K, 5nsm:L, 5nsq:A, 5nsq:B, 5nsq:C, 5nsq:D, 5nsq:E, 5nsq:F, 5ntd:A, 5ntd:B, 5ntd:D, 5ntd:C, 5ntd:E, 5ntd:F, 5ntd:H, 5ntd:I, 5ntd:J, 5ntd:K, 5ntd:L |
5 | 6yjo:A | 475 | 71 | 0.1065 | 0.0484 | 0.3239 | 4.7 | |
6 | 6plm:B | 752 | 71 | 0.1019 | 0.0293 | 0.3099 | 5.2 | 6k4r:A, 6k4r:B, 7mir:A, 7mis:A, 6oqq:A, 6oqq:C, 6plm:A, 6s5t:A |