BioLiP

>protein
LIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPK
IVN

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dvq:6	105	83	1.0000	0.7905	1.0000	2.93e-55	7abg:y, 7abh:y, 7abi:y, 7b0i:D, 7b91:D, 7b92:D, 7b9c:D, 8ch6:D, 6en4:D, 7evn:D, 7evo:6, 6ff4:y, 8hk1:6, 8i0p:7, 8i0r:7, 8i0s:7, 8i0t:7, 8i0u:7, 8i0v:7, 5ife:D, 7omf:D, 7onb:D, 7opi:D, 7q3l:G, 7q4o:G, 7q4p:G, 7qtt:D, 6qx9:BP, 8r08:BP, 5syb:A, 5syb:B, 7vpx:6, 6y50:y, 8y7e:6, 5z56:6, 5z57:6, 5z58:6, 5zya:D
2	2k0a:A	109	84	0.5904	0.4495	0.5833	1.79e-27	7dco:5, 6g90:S, 5gm6:J, 5lqw:Y, 5nrl:S, 5zwm:5
3	5c2v:D	770	23	0.1566	0.0169	0.5652	0.059	5c2v:A, 5c2w:A, 5c2w:D
4	8fo9:F	2289	68	0.2530	0.0092	0.3088	0.11	9c61:A, 9c61:B, 8fo2:E, 8fo7:C, 8fo8:C, 8fo8:E, 8fo9:E, 7lht:A, 7lht:B, 7lhw:A, 7li3:A, 7li4:A, 6oje:A, 6oje:B, 6ojf:A, 6ojf:B, 7thy:A, 7thz:A, 6xaf:A, 6xaf:B, 2zej:B
5	9bct:I	65	50	0.1807	0.2308	0.3000	0.13
6	8u8b:A	1712	68	0.2651	0.0129	0.3235	0.18	8u7l:B, 8u7l:A, 8u8a:B, 8u8a:C, 8u8b:B, 2zej:A
7	8tzf:A	1589	69	0.2530	0.0132	0.3043	0.35
8	6qf7:B	244	26	0.1325	0.0451	0.4231	1.2	6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C
9	8j56:C	160	39	0.2048	0.1062	0.4359	3.4	8j56:F
10	1ryq:A	64	28	0.0964	0.1250	0.2857	3.9	8oki:I, 8p2i:I, 3p8b:A, 3p8b:C, 3qqc:E
11	6cnb:B	1114	19	0.0964	0.0072	0.4211	4.8	8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B
12	6ukj:A	350	71	0.2410	0.0571	0.2817	6.4

[Back]