BioLiP

>protein
LHLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHK
IRMALKVLLDEKNHPVLIHSKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSSFS

The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mok:A	166	154	0.9935	0.9217	0.9935	5.38e-113	7moe:A, 7moe:B, 7mof:A, 7mof:B, 7mog:A, 7mog:B, 7moh:A, 7moh:B, 7moi:A, 7moi:B, 7moj:A, 7moj:B, 7mok:B, 7mom:A, 7mom:B
2	4r0s:A	162	128	0.1818	0.1728	0.2188	2.17e-06	4r0s:B, 4r0t:B
3	1qvr:A	803	75	0.1558	0.0299	0.3200	0.027	4fcv:A, 4fcv:B, 4fcv:C, 4fcw:A, 4fcw:C, 4fcw:F, 4fd2:A, 4fd2:B, 4fd2:D, 4lj5:A, 4lj6:A, 4lj7:A, 4lj7:B, 4lj7:C, 4lj8:A, 4lj9:A, 4lja:A, 1qvr:B, 1qvr:C
4	6qw6:64	73	74	0.1364	0.2877	0.2838	0.087	6qx9:64
5	4hse:A	369	67	0.1429	0.0596	0.3284	0.15
6	6w6j:D	707	74	0.1494	0.0325	0.3108	0.64	6dju:D, 6dju:E, 6djv:D, 6djv:E, 6djv:F, 7l6n:D, 7l6n:E, 7l6n:F, 6w6e:D, 6w6e:E, 6w6e:F, 6w6g:D, 6w6g:E, 6w6h:D, 6w6h:E, 6w6i:D, 6w6i:E, 6w6j:E
7	8tk2:A	181	87	0.1623	0.1381	0.2874	0.64	3f81:A, 3f81:B, 1j4x:A, 8tk2:B, 8tk3:A
8	3v0h:B	327	36	0.1039	0.0489	0.4444	0.85	3v0h:A
9	4erc:A	150	115	0.2143	0.2200	0.2870	2.4	4erc:B
10	3hee:A	148	47	0.0974	0.1014	0.3191	3.2	3hee:B, 3ph3:A, 3ph3:B, 3ph4:A, 3ph4:B
11	6g84:B	368	64	0.1039	0.0435	0.2500	7.2	6g84:A, 6g85:A, 6g85:B, 6g86:A, 6g86:B, 5xw5:A
12	1ygu:B	582	49	0.1039	0.0275	0.3265	8.1	1ygr:A, 1ygr:B, 1ygu:A
13	6h8s:A	291	53	0.0909	0.0481	0.2642	8.6	2cjz:A, 6h8r:A, 5ovr:A, 5ovx:A, 5ow1:A

[Back]