LHLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHK
IRMALKVLLDEKNHPVLIHSKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSSFS
The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7mok:A | 166 | 154 | 0.9935 | 0.9217 | 0.9935 | 5.38e-113 | 7moe:A, 7moe:B, 7mof:A, 7mof:B, 7mog:A, 7mog:B, 7moh:A, 7moh:B, 7moi:A, 7moi:B, 7moj:A, 7moj:B, 7mok:B, 7mom:A, 7mom:B |
2 | 4r0s:A | 162 | 128 | 0.1818 | 0.1728 | 0.2188 | 2.17e-06 | 4r0s:B, 4r0t:B |
3 | 1qvr:A | 803 | 75 | 0.1558 | 0.0299 | 0.3200 | 0.027 | 4fcv:A, 4fcv:B, 4fcv:C, 4fcw:A, 4fcw:C, 4fcw:F, 4fd2:A, 4fd2:B, 4fd2:D, 4lj5:A, 4lj6:A, 4lj7:A, 4lj7:B, 4lj7:C, 4lj8:A, 4lj9:A, 4lja:A, 1qvr:B, 1qvr:C |
4 | 6qw6:64 | 73 | 74 | 0.1364 | 0.2877 | 0.2838 | 0.087 | 6qx9:64 |
5 | 4hse:A | 369 | 67 | 0.1429 | 0.0596 | 0.3284 | 0.15 | |
6 | 6w6j:D | 707 | 74 | 0.1494 | 0.0325 | 0.3108 | 0.64 | 6dju:D, 6dju:E, 6djv:D, 6djv:E, 6djv:F, 7l6n:D, 7l6n:E, 7l6n:F, 6w6e:D, 6w6e:E, 6w6e:F, 6w6g:D, 6w6g:E, 6w6h:D, 6w6h:E, 6w6i:D, 6w6i:E, 6w6j:E |
7 | 8tk2:A | 181 | 87 | 0.1623 | 0.1381 | 0.2874 | 0.64 | 3f81:A, 3f81:B, 1j4x:A, 8tk2:B, 8tk3:A |
8 | 3v0h:B | 327 | 36 | 0.1039 | 0.0489 | 0.4444 | 0.85 | 3v0h:A |
9 | 4erc:A | 150 | 115 | 0.2143 | 0.2200 | 0.2870 | 2.4 | 4erc:B |
10 | 3hee:A | 148 | 47 | 0.0974 | 0.1014 | 0.3191 | 3.2 | 3hee:B, 3ph3:A, 3ph3:B, 3ph4:A, 3ph4:B |
11 | 6g84:B | 368 | 64 | 0.1039 | 0.0435 | 0.2500 | 7.2 | 6g84:A, 6g85:A, 6g85:B, 6g86:A, 6g86:B, 5xw5:A |
12 | 1ygu:B | 582 | 49 | 0.1039 | 0.0275 | 0.3265 | 8.1 | 1ygr:A, 1ygr:B, 1ygu:A |
13 | 6h8s:A | 291 | 53 | 0.0909 | 0.0481 | 0.2642 | 8.6 | 2cjz:A, 6h8r:A, 5ovr:A, 5ovx:A, 5ow1:A |