LHALLRDIPAPDAEAMARTQQHIDGLLKPPGSLGRLETLAVQLAGMPGLNGTPQVGEKAVLVMCADHGVWDEGVAVSPKI
The query sequence (length=346) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
1jh8:A |
348 |
346 |
0.9971 |
0.9914 |
0.9971 |
0.0 |
1d0s:A, 1d0v:A, 1jha:A, 1jhm:A, 1jho:A, 1jhp:A, 1jhq:A, 1jhr:A, 1jhu:A, 1jhv:A, 1jhx:A, 1jhy:A, 4kqf:A, 4kqg:A, 4kqi:A, 4kqj:A, 4kqk:A, 1l4b:A, 1l4e:A, 1l4f:A, 1l4g:A, 1l4h:A, 1l4k:A, 1l4l:A, 1l4m:A, 1l4n:A, 1l5f:A, 1l5k:A, 1l5l:A, 1l5m:A, 1l5n:A, 1l5o:A |
2 |
4hdr:A |
335 |
339 |
0.3555 |
0.3672 |
0.3628 |
8.09e-57 |
4hdk:A, 4hdm:A, 4hdr:C, 4hds:A |
3 |
4hdr:B |
329 |
346 |
0.3555 |
0.3739 |
0.3555 |
1.47e-46 |
4hdk:B, 4hdm:B, 4hdr:D |
4 |
6gyr:A |
588 |
53 |
0.0520 |
0.0306 |
0.3396 |
1.2 |
5bt3:A, 8fvf:A, 8fvf:B, 6gyr:B, 6gyr:C, 6gyr:D, 5i8b:A, 5i8g:A, 5lpk:A, 5lpk:B, 5lpk:C, 5lpk:D, 5lpk:E, 5lpk:G, 5lpk:F, 5lpm:A, 5lpm:B, 5nu5:A, 5nu5:B, 4pzr:A, 4pzs:A, 4pzt:A, 7ugi:A, 7ugi:B, 6v8n:A, 6v90:A |
5 |
4bhw:A |
563 |
53 |
0.0520 |
0.0320 |
0.3396 |
1.3 |
4bhw:B, 3biy:A, 8gzc:A, 8gzc:B, 8haj:K, 5kj2:A, 7lje:A, 7lje:B, 7lje:C, 7lje:D, 5lkt:A, 5lku:A, 5lkx:A, 5lkz:A, 6pf1:A, 6pf1:B, 6pgu:A, 6pgu:B, 7szq:A, 6v8b:A, 6v8k:A, 7vhy:A, 7vhy:B, 7vhz:A, 7vhz:B, 7vi0:A, 7vi0:B |
6 |
7ss8:A |
484 |
53 |
0.0520 |
0.0372 |
0.3396 |
1.5 |
6gyt:A, 6gyt:B, 7ssk:A |
7 |
8hai:K |
533 |
53 |
0.0520 |
0.0338 |
0.3396 |
1.6 |
8hag:K, 8hah:K, 8hak:N |
8 |
1wqa:A |
455 |
114 |
0.0896 |
0.0681 |
0.2719 |
4.7 |
1wqa:B, 1wqa:C, 1wqa:D |
9 |
5u7g:A |
547 |
53 |
0.0491 |
0.0311 |
0.3208 |
6.3 |
4a9k:A, 4a9k:B, 6alc:B, 6axq:A, 6axq:B, 6axq:C, 6axq:D, 6ay3:A, 6ay3:B, 6ay5:A, 5cgp:A, 8cmz:A, 8cn0:A, 8cna:A, 8cnb:A, 8cnd:A, 2d82:A, 5dbm:A, 5dbm:B, 5dbm:C, 6dmk:A, 5eic:B, 5eng:A, 5ep7:A, 7evj:A, 6fqo:A, 6fqo:B, 6fqt:A, 6fqu:A, 6fr0:A, 6fr0:B, 6frf:A, 6frf:B, 6frf:C, 6frf:D, 8fup:A, 8fup:B, 8fv2:A, 8fv2:B, 8fv2:C, 8fv2:D, 8fvs:A, 8fvs:B, 8fxa:A, 8fxa:B, 8fxe:A, 8fxn:A, 8fxo:A, 8g6t:A, 8g6t:B, 8g6t:C, 8g6t:D, 8ga2:A, 8ga2:D, 8ga2:C, 8ga2:B, 5gh9:A, 5h85:A, 5i83:A, 5i86:A, 5i86:B, 5i89:A, 5j0d:A, 1jsp:B, 7juo:A, 7juo:B, 7juo:D, 7juo:C, 7juo:F, 7juo:E, 7juo:G, 7juo:H, 7kpy:A, 7kpy:B, 5ktu:A, 5ktu:B, 5ktw:A, 5ktw:B, 5ktw:C, 5ktx:A, 2l84:A, 2l85:A, 5lpj:A, 5lpl:A, 6lqx:B, 5mme:A, 5mme:B, 5mmg:A, 5mpk:A, 5mpk:B, 5mpn:A, 5mpz:A, 5mqe:A, 5mqe:B, 5mqg:A, 5mqg:B, 5mqk:A, 5mqk:B, 2n1a:B, 4n3w:A, 5nlk:A, 4nr4:A, 4nr4:B, 4nr5:A, 4nr6:A, 4nr7:A, 5nrw:A, 5nu3:A, 4nyv:A, 4nyv:B, 4nyv:C, 4nyv:D, 4nyw:A, 4nyx:A, 8og2:A, 5owk:A, 3p1c:A, 3p1d:A, 3p1f:A, 3p1f:B, 6qst:A, 6qst:B, 6qst:C, 6qst:D, 2rny:A, 6sqe:A, 6sqf:A, 6sqm:A, 6sqm:B, 6sqm:C, 3svh:A, 3svh:B, 6sxx:A, 6sxx:B, 5tb6:A, 1tot:A, 4tqn:A, 4ts8:A, 5u7g:B, 7uge:A, 7uge:B, 7ugl:A, 7ugl:B, 5w0e:A, 5w0f:A, 5w0i:A, 5w0l:A, 5w0l:B, 5w0q:A, 4whu:A, 7wx2:A, 7xh6:A, 7xh6:B, 7xhe:A, 7xhe:B, 7xi0:A, 7xi0:B, 7xm7:A, 7xm7:D, 7xm7:C, 7xne:A, 7xne:B, 7xng:A, 7xng:B, 5xxh:A, 6yij:A, 6yij:B, 6yij:C, 6yij:D, 6yij:E, 6yij:F, 6yij:G, 6yik:A, 6yik:C, 6yik:B, 6yil:A, 6yim:A, 4yk0:A, 4yk0:B, 4yk0:C, 4yk0:D |
10 |
8ham:K |
517 |
53 |
0.0491 |
0.0329 |
0.3208 |
8.8 |
6alb:A, 8hal:K |
11 |
8han:K |
500 |
53 |
0.0491 |
0.0340 |
0.3208 |
9.0 |
4n4f:A |