LHAFVRSPHYRTIPSAGPNGIVVNRDMLVHQFRDFYKTLQHCSLVDKVHLMSERPSVEALRVADQMVSIGATFLEMPLTG
MEHRATEFMESMRYVRGAGGPSTLASYLQDTENCRCNSGDVVCLPNGIAVGHGPRTNAVAHTTLKQLFEVKDDQFSFDVF
TLEQEGDAPPLGDYFGFAGSNVLLTWKDEHGLLAVDQYQQKQPHTEMNVVYLEPGCHFLSFYGVDHTIDVLVQKGYERSM
DSIAAAGLNPIPVQWSEMDKLGISMRAAVLPLKFFKANVGGMLSRNKSRGARWQTHQ
The query sequence (length=297) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fnc:5 | 297 | 297 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8fn6:5, 8fnf:5, 8fni:5, 8fnk:5 |
2 | 2vwt:A | 256 | 114 | 0.0842 | 0.0977 | 0.2193 | 0.30 | 2vwt:B, 2vwt:C |
3 | 4bs9:A | 691 | 55 | 0.0640 | 0.0275 | 0.3455 | 0.90 | |
4 | 6ct6:B | 331 | 54 | 0.0640 | 0.0574 | 0.3519 | 1.5 | 6ct6:A |
5 | 7et9:A | 254 | 75 | 0.0606 | 0.0709 | 0.2400 | 2.7 | 7et9:B, 7et9:C, 7eta:A, 7eta:B, 7eta:C, 7etb:A, 7etb:B, 7etb:C, 7etc:A, 7etc:C, 7etc:B, 7etd:A, 7etd:B, 7etd:C, 7ete:A, 7ete:C, 7ete:B, 7etf:A, 7etf:B, 7etf:C, 7etg:A, 7etg:B, 7etg:C, 7eth:A, 7eth:B, 7eth:C, 7eti:A, 7eti:B, 7eti:C |
6 | 3i76:B | 229 | 61 | 0.0640 | 0.0830 | 0.3115 | 3.1 | 3i76:A, 3i76:C |
7 | 6xfk:A | 63 | 39 | 0.0505 | 0.2381 | 0.3846 | 6.3 | |
8 | 6ixx:A | 463 | 43 | 0.0404 | 0.0259 | 0.2791 | 6.4 | 1g9k:A, 1h71:P, 1o0q:A, 1o0t:A, 1om6:A, 1om7:A, 1om8:A, 1omj:A, 3u1r:A |
9 | 1n1e:A | 349 | 72 | 0.0741 | 0.0630 | 0.3056 | 8.1 | 1evz:A, 1jdj:A, 1m66:A, 1m67:A, 1n1e:B, 1n1g:A |
10 | 6ly5:a | 742 | 69 | 0.0707 | 0.0283 | 0.3043 | 8.7 | 6l4u:A |
11 | 7sza:A | 233 | 75 | 0.0741 | 0.0944 | 0.2933 | 8.9 | 7sza:C, 7szb:A, 7szb:C, 7szc:A, 7szc:C, 7szd:A, 7szd:C, 6wqx:C, 6wqx:D |
12 | 7tbw:A | 1928 | 144 | 0.1347 | 0.0207 | 0.2778 | 9.7 | |
13 | 7e7l:A | 770 | 86 | 0.0741 | 0.0286 | 0.2558 | 9.9 | 7e7l:B |