LGYTPINPDTSPMLMYSQCHWHYNLPQGMERPSSVNRSLPAPYQPHHSSVNKYRGVWISTEMHPAFLVGLAPQLKKLPHG
RVVPQTPVAEVIDEFNKLSPLIDDAAARDGWLAKIFQHCAFQRSGAEAMALWDKHCAPRFMRDDSASAPPLPLVQAILFC
CSKSDSAEWRPIFTKCLKDGWNYTPSFDTPQWSYLLKSLGRQGDEEGVRLVLEEMADVQADLDRVEARSLVYALNAVHDK
AIYNYVKKYLFYLGERKVKFLRITYADLRGHGAEKLRVPLKENDSMFYHVCWHASIRQPRQFSPRQLYFDYAPSQL
The query sequence (length=316) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ane:aj | 316 | 316 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 7aor:aj | 315 | 316 | 0.7089 | 0.7111 | 0.7089 | 1.15e-172 | |
3 | 7pub:DJ | 357 | 316 | 0.6867 | 0.6078 | 0.6867 | 5.58e-172 | 6hiv:DJ, 6hiw:DJ, 6hiz:DJ, 7pua:DJ, 6sg9:DJ, 6sgb:DJ |
4 | 6y1x:A | 252 | 42 | 0.0506 | 0.0635 | 0.3810 | 1.9 | 6y1x:B |
5 | 6sga:F7 | 662 | 47 | 0.0506 | 0.0242 | 0.3404 | 4.2 | 7pua:F7, 7pub:F7, 6sgb:F7 |
6 | 8q9v:A | 543 | 106 | 0.0886 | 0.0516 | 0.2642 | 6.2 | 8q9u:A |
7 | 7qh8:A | 471 | 116 | 0.0854 | 0.0573 | 0.2328 | 8.2 | 7qhn:A, 7qi8:A |