BioLiP

>protein
LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEAN
AARK

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8q7n:J	260	84	1.0000	0.3231	1.0000	7.43e-54	6ahd:J, 8h6k:4B, 8h6l:4B, 5o9z:E, 8qo9:J, 8qoz:J, 8qp8:J, 8qp9:J, 8qpa:J, 8qpb:J, 8qpe:J, 8qzs:J, 8r09:J, 8r0b:J, 8rm5:J
2	6qw6:4A	239	84	0.7976	0.2803	0.7976	1.49e-36	6qx9:4A
3	8y6o:N	228	36	0.4286	0.1579	1.0000	1.31e-17	8h6e:4B, 8h6j:4B, 8qxd:J, 8r08:J
4	8r0a:J	159	46	0.4048	0.2138	0.7391	1.55e-13
5	5nrl:G	372	81	0.4167	0.0941	0.4321	1.83e-10	3jcm:K, 4yhw:A, 4yhw:B, 5zwm:J, 5zwo:J
6	5gan:G	318	81	0.4167	0.1101	0.4321	7.44e-10	5gap:G
7	2o1u:A	578	62	0.1786	0.0260	0.2419	0.61	2o1u:B, 2o1v:A, 2o1v:B, 1tbw:B, 1tc0:B, 1tc6:B, 1yt0:A
8	5uls:A	650	62	0.1786	0.0231	0.2419	0.74	6aol:A, 6aom:A, 6aom:B, 6asp:A, 6asp:B, 6asq:A, 6asq:B, 6baw:B, 6baw:A, 6baw:C, 6baw:D, 6c91:C, 6c91:B, 6cyi:A, 6d1x:A, 6d28:A, 2esa:A, 2exl:A, 2exl:B, 2fyp:A, 2fyp:B, 2gfd:A, 2gfd:B, 2gqp:A, 2gqp:B, 2h8m:A, 2h8m:B, 2hch:A, 2hch:B, 2hg1:A, 2hg1:B, 5in9:A, 5in9:B, 4nh9:A, 3o2f:A, 3o2f:B, 1qy8:A, 1qye:A, 1tbw:A, 1tc0:A, 1tc6:A, 5ttz:A, 5ttz:B, 1u0z:A, 1u0z:B, 1u2o:A, 1u2o:B, 5uls:B, 7ull:A, 7ull:B, 5wmt:A, 5wmt:B, 5wmt:C, 5wmt:D, 1ysz:A
9	6tux:A	330	57	0.1548	0.0394	0.2281	0.80	6tuw:A, 6tux:B
10	8q7n:F	431	64	0.2024	0.0394	0.2656	5.4	5o9z:F, 8qpa:F
11	3fzy:A	216	27	0.1071	0.0417	0.3333	5.5	3eeb:A, 3eeb:B, 3fzy:B, 3gcd:A, 3gcd:B, 3gcd:C, 3gcd:D, 8yja:A, 8yja:B, 8yjc:A

[Back]