BioLiP

>protein
LGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDM
FVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLF
FIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQK
WAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFT
YLDYENREPDYYLTRTAYWVGKFRESK

The query sequence (length=347) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6zj6:AAA	360	347	1.0000	0.9639	1.0000	0.0	4ad2:A, 4ad2:B, 4ad2:C, 4ad2:D, 4ad3:A, 4ad3:B, 4ad3:C, 4ad3:D, 4ad4:A, 4ad5:A, 6fam:A, 6far:A, 6fwg:A, 6fwi:A, 6fwj:A, 6fwl:A, 6fwm:A, 6fwo:A, 6fwp:A, 6fwq:A, 6hmg:A, 6hmh:A, 5lyr:A, 5m03:A, 5m17:A, 5m3w:A, 5m5d:A, 5mc8:A, 5mel:A, 4utf:A, 4v27:A, 4v28:A
2	6zdk:AAA	362	348	0.4524	0.4337	0.4511	2.91e-100	6zdl:AAA, 6zfa:AAA, 6zfn:AAA, 6zj1:AAA, 6zj5:AAA
3	1ewq:A	759	122	0.0922	0.0422	0.2623	0.23	1ewq:B, 1fw6:A, 1fw6:B, 1nne:A, 1nne:B
4	4oau:C	692	32	0.0375	0.0188	0.4062	1.4	4g8l:A, 4g8l:B, 4g8l:C, 4g8l:D, 4oav:B, 4oav:D, 1wdy:A
5	1r66:A	322	65	0.0548	0.0590	0.2923	1.6	1r6d:A
6	3zsc:A	329	64	0.0548	0.0578	0.2969	1.7
7	7op8:A	1118	94	0.0634	0.0197	0.2340	2.0	7op1:A, 7op3:A, 7op5:A
8	6akz:A	451	29	0.0346	0.0266	0.4138	6.2
9	4liq:E	469	148	0.1009	0.0746	0.2365	6.4
10	3dje:B	437	91	0.0692	0.0549	0.2637	8.1	3djd:A, 3djd:B, 3dje:A
11	4n58:A	266	66	0.0548	0.0714	0.2879	8.2	4n58:B, 4n59:A, 4n59:B

[Back]