LGRPAPVMEREHDRPAALDHPRAPRKPRGIPYFEKYAWLFMRFSGIALVFLALGHLFIMLMWQDGVYRIDFNYVAERWAS
PFWQIWDMALLWLAMIHGANGMRTIIGDYARKNVTKFWLNSLLLLATGFTLVLGSYVLVTFDANIS
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6lum:D | 146 | 146 | 1.0000 | 1.0000 | 1.0000 | 4.29e-106 | 6lum:H, 6lum:N |
| 2 | 2bs2:F | 254 | 115 | 0.1986 | 0.1142 | 0.2522 | 0.82 | 2bs2:C, 2bs3:F, 2bs3:C, 2bs4:F, 2bs4:C, 1e7p:C, 1e7p:F, 1e7p:I, 1e7p:L, 1qlb:C, 1qlb:F |
| 3 | 2kup:A | 146 | 27 | 0.0822 | 0.0822 | 0.4444 | 2.2 | 2ys5:A |
| 4 | 5hdt:A | 1085 | 54 | 0.1027 | 0.0138 | 0.2778 | 3.7 | 5hdt:B |
| 5 | 6fti:3 | 120 | 70 | 0.1507 | 0.1833 | 0.3143 | 8.5 | 8pn9:H |
umich.edu