LGPAVIASIAYMDPGNFATNIEGGARYGYSLLWVILAANLMAMVIQNLSANLGIASGRNLPELIRERWPRPLVWFYWIQA
ELVAMATDLAEFLGAALAIQLLTGLPMFWGAVVTGVVTFWLLNLQKRGTRPLELAVGAFVLMIGVAYLVQVVLARPDLAA
VGAGFVPRLQGPGSAYLAVGIIGATVMPHVIYLHSALTQGRIQTDTTEEKRRLVRLNRVDVIAAMGLAGLINMSMLAVAA
ATFHGKNVENAGDLTTAYQTLTPLLGPAASVLFAVALLASGLSSSAVGTMAGDVIMQGFMGFHIPLWLRRLITMLPAFIV
ILLGMDPSSVLILSQVILCFGVPFALVPLLLFTARRDVMGALVTRRSFTVIGWVIAVIIIALNGYLLWELLGG
The query sequence (length=393) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8e6n:A | 398 | 393 | 0.9975 | 0.9849 | 0.9975 | 0.0 | 8e60:A, 8e6h:A, 8e6i:A, 8e6l:A |
2 | 5m95:A | 395 | 395 | 0.3842 | 0.3823 | 0.3823 | 7.60e-90 | 5m95:C |
3 | 5m87:A | 494 | 421 | 0.3842 | 0.3057 | 0.3587 | 3.29e-65 | 6tl2:A |
4 | 6dgm:B | 382 | 117 | 0.0738 | 0.0759 | 0.2479 | 0.46 | 6dgm:A, 5u9z:A, 5u9z:B, 5wcx:A, 5wcx:B |
5 | 8fnc:8 | 516 | 40 | 0.0382 | 0.0291 | 0.3750 | 2.3 | 8fnf:8, 8fni:8, 8fnk:8 |
6 | 5azb:A | 284 | 52 | 0.0433 | 0.0599 | 0.3269 | 2.4 | 5azc:A |
7 | 8u51:A | 267 | 24 | 0.0331 | 0.0487 | 0.5417 | 9.6 |