LGMRKNGQVWLPAKKAFRPTKGLTSWELRVKKRQEQAAMKAKEREMKEEKEAERQKRIQAIKERRKKKEE
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8pv6:Cz | 103 | 70 | 1.0000 | 0.6796 | 1.0000 | 8.50e-43 | 8i9t:Cz, 8i9v:Cz, 8i9w:Cz, 8i9x:Cz, 8i9y:Cz, 8i9z:Cz, 8ia0:Cz, 8pv1:Cz, 8pv2:Cz, 8pv3:Cz, 8pv4:Cz, 8pv5:Cz, 8pv7:Cz, 8pv8:Cz, 8pvk:Cz, 8pvl:Cz |
| 2 | 4ktz:A | 160 | 25 | 0.1714 | 0.0750 | 0.4800 | 0.22 | 4ktz:B |
| 3 | 6ylg:5 | 78 | 42 | 0.2857 | 0.2564 | 0.4762 | 1.5 | 6ft6:5, 3jct:5, 6m62:5, 7oh3:5, 7ohq:5, 7uoo:5, 7uqb:5, 7uqz:5, 7v08:5, 6ylh:5 |
| 4 | 7vgh:B | 1183 | 67 | 0.2857 | 0.0169 | 0.2985 | 5.1 | 7vgi:B |
umich.edu